KEGG   Vibrio cholerae IEC224: O3Y_05280Help
Entry
O3Y_05280         CDS       T01766                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00340  Histidine metabolism
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01230  Biosynthesis of amino acids
Module
vci_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    O3Y_05280 (hisD)
Enzymes [BR:vci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     O3Y_05280 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFC57936
Position
I:1199203..1200498
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSEAQQESILERPAITEGANITAAVAQVIAKVRSEGDAALFELTEKFDRVKP
ASLRVSREEMDAAAARLSETMKQALEQAYNNISKFHKAQKAQPIKVETMPGVVCEQVTRP
INKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
LGGGQAIAAMAYGTETVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADANFIAADLLSQAEHGPDSQVVLVTPSPVLADQVTDAVQKQLKVLSRASIAEKALA
SSLIIIAESLTQAVSISNYYGPEHLIVQTRNPRELVPLLDNAGSIFLGDWSPESVGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTVQELTADGLQLLAPTVVTMAEAEGLDAHKRAV
TIRVEKLQKAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtggtttggcaatcgttgagtgaagctcagcaagaatcgattttagaacgt
cctgcgattaccgaaggagcaaacatcactgccgcagttgcgcaggtgattgcgaaagtg
cgcagtgagggtgatgccgcactgtttgaattaactgaaaaatttgatcgtgtaaaaccc
gcttcactgcgcgtatctcgcgaagagatggatgccgcggccgcgcgtttgtcggaaaca
atgaaacaggcgttggagcaggcatacaacaacatcagcaaattccacaaggcgcaaaaa
gcgcaaccaatcaaagtggaaaccatgcccggagtggtgtgtgagcaagtcactcgtccg
atcaacaaagtgggtctgtatattccgggtggcagcgcaccgctaccatcaaccgtacta
atgctcggtgtgcctgcgcaaatcgctggttgtcgtaaagtggtgctctgctcacctccg
ccaattgctgatgaaattctctacgtcgctaagctgtgtaacatcgatgaggtgtacaac
ctaggcggcggtcaggcaatcgccgcaatggcttacggtacggaaacggtgactaaagtt
gacaaaatctttggccccggtaacgcctatgtgacggaagcaaaacgccaagtgagtaac
gatttccgtggcgcagcgattgatatgcctgcaggaccttcagaagtattggtgattgct
gatgaaacggcggatgccaattttatcgccgccgatctactcagtcaggcagagcacggc
ccagattcacaggtggttctggtcacaccatcaccagtgttggccgatcaagtgacggac
gcagtgcaaaagcagcttaaagtgctttcgcgcgccagcattgctgaaaaagccttggct
tccagtctgatcattattgctgaatcactcacccaagcagtgtcgatttctaactactac
ggccctgagcacttgattgtgcagacgcgcaacccgcgtgagttggttccactgctcgat
aacgcaggctccattttccttggcgattggtcgccagaatcggtaggcgattacgcttct
ggtaccaaccatgtgctacccacttacggttacacccgcacctattccagcttaggtttg
gccgatttcagtaaacgcatgacagtgcaagagctgaccgctgatggcttgcaattgctt
gcgcccaccgtagtaacgatggcggaagcggaagggttagacgcgcacaaacgtgcggtt
acgattcgagtagaaaaattacagaaggctcaataa

DBGET integrated database retrieval system