KEGG   Vibrio cholerae O1 IEC224: O3Y_06225Help
Entry
O3Y_06225         CDS       T01766                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci00640  Propanoate metabolism
vci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    O3Y_06225
Enzymes [BR:vci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     O3Y_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AFC58123
Position
I:1419066..1421672
Genome map
AA seq 868 aa AA seqDB search
MNSLYRKALSPSPAQSQVDFFDTRAAVEALKPGAYQTLPYTARILAENLVRRCPPEQLSE
SLLQIIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVETQL
IVDHSLAVEYSGCDPDAFEKNRAVEDRRNEDRFHFIEWCKTAFKNVSVIPAGNGIMHQIN
LEKMSPVIQVKEGVAFPDSCVGTDSHTPHVDALGVLAIGVGGLEAETVMLGRPSMMRLPD
IVGVKLTGARQPGITATDIVLALTEFLRRERVVSAYLEFFGEGAKALTIGDRATISNMTP
EYGATAGMFYIDEQTIQYLKLTGREPEQVALVESYAKAAGLWADSLEHAEYERVLEFDLS
SVERNLAGPSNPHRRLPTKDLSARGIAIPAQQREAQQAEGLMPDGAVIIAAITSCTNTSN
PRNVVAAGLLAKKANQLGLKRQPWVKTSFAPGSKVAKLYLQEAGLLSELEQLGFGIVAYA
CTTCNGMSGALDPAIQQEIIERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAI
AGTMRFDIERDALGHDAQGKPIYLNHLWPSDEEIDAVVGRAVKPEQFKQIYIQMFKLDET
QSASSPLYDWRPMSTYIRRPPYWEGALAAPRTLKAMRPLAILGDNITTDHLSPSNAILAS
SAAGEYLTKMGVPEEDFNSYATHRGDHLTAQRATFANPKLFNEMVKENGQIKQGSLARIE
PEGKVTRMWEAIETYMNRKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIH
RTNLVGMGVLPLEFKPGVNRHSLALDGTELFDVVGEIRPGADLALVVTRQNGEKLDVAVT
CRLDTADEVHVYQAGGVLQRFAQDFLAQ
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtctgtatcgtaaagccttatcgccaagccctgcgcaatctcaggtcgatttt
tttgatacgcgcgcggcggtcgaggcgttaaaaccgggcgcataccaaactttgccttat
acggcacgtattctggccgaaaacttagtgcgccgctgcccgccggagcaattgagcgaa
agtctgctgcaaattatcgagcgtaaacgcgatcttgatttcccttggtatcccgcgcgc
gtggtgtgccacgatattctcggccaaaccgcgttggttgatttggcgggcttgcgtgat
gcgattgccgaacaaggcggcgaccccgcgcaagtcaatcctgtcgtagagactcagttg
attgtcgatcactcgttggcggtggaatattctggctgcgatcctgatgcgtttgaaaaa
aatcgcgcagtagaagacagacgcaacgaagatcgcttccactttatcgagtggtgcaaa
accgcgttcaaaaacgtcagtgtgatccctgccggtaacggcatcatgcaccagatcaat
ctggaaaaaatgtcgccggtgatacaggtgaaagagggcgtggctttccctgattcttgc
gtaggcacagatagccatacgccgcacgttgatgcactcggtgtgctggcaattggtgtg
ggcggccttgaagcggaaaccgtaatgctcggtcggccttccatgatgcgcttgccagat
attgtcggtgtgaaactgaccggagcgcgccaaccgggcattaccgcaaccgatattgtg
ttggccttaaccgaatttctgcgccgcgagcgcgtggtctcagcctatctggaatttttt
ggcgaaggggcgaaagcgctgaccattggcgatcgcgcgactatttccaatatgacgccg
gaatacggtgcgaccgccggcatgttctacattgatgaacagaccattcaatatttgaaa
ctcacaggccgcgagccagagcaagttgctttggtcgaaagctacgccaaagccgcaggt
ttatgggcggacagcttagagcacgcggaatacgaacgtgtgctggagtttgatctctcc
agtgttgagcgcaatttggcggggccttccaatccgcatcgccgtttgccgaccaaagat
ctgagcgcgcgcggcattgccatacctgctcagcaacgagaagcacaacaagcagagggc
ttgatgcctgatggcgcggtgatcatcgccgctatcacttcctgtaccaacaccagtaac
ccgcgcaacgtggttgcggcagggctactcgccaaaaaagctaatcagctcggccttaaa
cgtcaaccttgggtgaaaacctctttcgcgcccggctcgaaagtcgccaaattgtatttg
caagaagctgggctgctctctgaactcgaacagcttggttttgggattgtggcgtatgcc
tgtaccacctgtaacggcatgagtggcgcgctcgatcccgctattcaacaagaaattatt
gaacgcgatctctacgctacagcggtactgtctggcaaccgcaactttgatggccgtatc
catccgtatgccaaacaagcgtttttggcttcgccgccactggtcgtggcttacgcgata
gcaggcacgatgcgctttgatattgagcgtgacgcgctgggtcacgatgcgcaaggcaag
ccgatttatctcaatcacttatggccaagtgatgaagagattgatgccgtcgttggccgc
gcggtcaagccggagcagttcaagcagatctatatccagatgtttaaactcgatgagaca
caaagcgcgagctcgccgctgtatgactggcggccgatgagcacgtatattcgccgtcca
ccgtattgggaaggggcgttggctgcaccgcgtaccctgaaagcgatgcgaccactggcg
attttgggtgacaacatcaccacggatcatttatcgccctccaatgccattttggcgagc
agcgcagcaggcgaatacctaactaaaatgggtgtgccggaggaagattttaactcttac
gccacccaccgtggcgatcacctgactgcgcagcgcgcgacgtttgccaacccgaaactg
tttaacgaaatggtcaaagaaaacgggcaaatcaagcaaggttctctcgcgcgtattgag
ccggaaggcaaagtgacgcgcatgtgggaagcgattgaaacttacatgaaccgcaaacaa
ccgctgattgtgatcgcgggagcggattatgggcaaggctcatcacgcgactgggcggcc
aaaggcgtgcgtttagccggcgttgaagcgattgttgccgaaggctttgagcgcattcac
cgcaccaacttggttgggatgggcgtactgccgctagagtttaagccgggcgtcaatcgc
cactcgctagcgctcgatggcactgagctgtttgatgtggtgggtgagatcaggcccggt
gcagatttagccctagtcgttaccagacaaaacggtgagaagctcgatgtggcggtgacg
tgtcgtttggacacggccgatgaagtgcacgtatatcaagcgggtggcgtgttgcaacgc
tttgcgcaagactttttggcgcagtag

DBGET integrated database retrieval system