KEGG   Vibrio cholerae O1 IEC224: O3Y_06560
Entry
O3Y_06560         CDS       T01766                                 

Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    O3Y_06560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_06560
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_06560
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AFC58190
Structure
PDB: 
5MXN

Position
I:1506660..1507178
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASI
VDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggccaaactcagggtcttatcactgcaggt
gcatgtactgctgactctatcggcgattcattcgttgaaggccacgaagatgagatgctg
gttcagcagtttgaccacgttgtgactgtaccgactgacccacaatctggtcagccttca
ggccaacgtgtgcacaagccattcaaattcactgtggcgctgaacaaagcggttcctctg
ctgtacaacgcgctctcttctggtgagaagctgaaaaccgttgagctgaagtggtaccgt
acctctatcgaaggtaaacaagagaacttcttcaccactaagctggaaaacgcgtctatc
gtcgacatccactgtgaaatgccacactgccaagacccagcaaaatctgactttactcag
aatgtgactgtgtctctgtcttaccgcaaaatcacttgggaccacgttaacgcgggcacc
tcaggctctgatgactggcgtaagccaatcgaagcgtaa

DBGET integrated database retrieval system