KEGG   Vibrio cholerae O1 IEC224: O3Y_06575Help
Entry
O3Y_06575         CDS       T01766                                 

Definition
(GenBank) hypothetical protein
Organism
vci  Vibrio cholerae O1 IEC224
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_3 CarboxypepD_reg SdrD_B
Motif
Other DBs
NCBI-ProteinID: AFC58193
Position
I:1511639..1513564
Genome map
AA seq 641 aa AA seqDB search
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKI
AAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWD
EAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSY
TFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAA
VIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLH
KIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALS
DESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLI
ENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggattcatttaattattgcgtgcagtgtaaccctgaggaaaactggttagagctagag
tttcggagtgaaaatgatgaaccgatagatggtttgctagttacgattacgaaccaaagt
gccccctctaacacatacacgcaaaccacaagttcgggtaaggtgttgtttggcaagatt
gcggctggggaatggcgtgcttctgtaagccaagcttctctgttaactgaagtcgaaaaa
tatgccagccgtaaagagggacaagagtcgccagtgaaaaaacgagctgcggcagaactt
gacgccgcagataaagatacgaagcagtaccgctttaccactattggtgatttctgggat
gaagcaccaaaagatgagtttttacaaaagcagcataaagggatagatgtcaatgcttct
gctgagaaagcagggtttagactcagtcataaccagacctatgtttttgaaatcaaagca
ctacgtagctatatgccagtgattattgataccgatgaatttaacttggtgaatagttat
acctttgcgttgttgtcgaaattagcttatgcgactaacgattttaatagggatgatggt
aagacaatagataatcagggagcaattagcacggttatttctcaattgaagcgtaaagaa
agaccgacttattctggagatttacaagcaaagtggttattagaggaaattccatatagc
aaagcgttaagtgcccaatattatgctgaggatgatgtcggtagtgaaggttacatcatc
tttaacgatgaattggcgattataggtgtgagaggtacagagccttattttcagagtaag
aaaccacctgttgataacactaaatttaaaattataaaagcggcttcaggtatggcggct
gtgattgcggataagatagaaagtgctaccgattcaccaggaatgaaagaccttattata
acagaccttgatgctgcgcaaatcgcccccgaagagtttggtggaacatatgttcatcgg
gggttttaccaatatacgatggctttgttatctttgatggagaaagatctagggctacat
aaaataaaaaaattctattgttgtggccatagcttagggggcgctggtgcattacttata
agtgcattgattaaagatagctatcatcctccagtattgcgtttatatacatatggaatg
ccacgagtgggaactcgcagttttgtagagcgctatcaaaatattttgcattaccgtcat
gttaataatcacgatttggtgccacagataccaacagtatggatgaacacagatgtatct
gaaggattccatgtacttgatgtatttaaaagccgtgttgatctgatgagaaaaatgctc
actgatgatgatgatgacaattatcaacaccatggtcatttgtctcagttactaacttat
aattcaaataaccaagtcttactgacacccaaacaaactcaagtcactatgctagaccta
gcaaatttagccactaatgattctgttgctatggtagatggtttatcagatgcctcaata
gtagagcatggaatggagcagtatatacccaatttatttgagcagttaacagcactaagt
gatgaaagtttaatggtgcattatcaacgagcgatttcagccttagagcaggaaattgct
acgttgcaacaaagttatcttacagttaaacaagcttggattgaatctataggaaatggc
acgccgactatgaatatcggacgtttgatgagtgaaatgcattctataaataaattaata
gagaaccgtaataaaattagaggtgagctaaggcagatagtctctgatcctcagcgtatg
cctgcaactaaatttttaatttcacagcaaaccttaccagatgaaatcaaggtgcaaata
agatga

DBGET integrated database retrieval system