KEGG   Vibrio cholerae O1 IEC224: O3Y_06580
Entry
O3Y_06580         CDS       T01766                                 

Definition
(GenBank) hypothetical protein
Organism
vci  Vibrio cholerae O1 IEC224
SSDB
Motif
Pfam: YobH
Other DBs
NCBI-ProteinID: AFC58194
Position
I:1513561..1514304
AA seq 247 aa
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLE
VWTHFWVTGDECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNC
IVELRDFSIQAHNDFDTVGFAQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEW
AGAIGCHFYVDGKKKTKDEEFNAYTIYYDFSKFNNDTVIHYDILAGENYRSEPLSSAQKT
AVVSDDN
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagttattgaataatcttgcaataaaaaagctaatctcagttgttgtactattcatt
gcattattttttcttgggtatgactattaccagacttctcaacctaatatttggggtgat
gaacctgatgagtcctatattactatatcaggcaaaaagcctatagatgcttatttagaa
gtgtggactcatttttgggtgacaggagatgagtgtgaagcttattcctacgatttattt
ggtcaaaaagcccatcaaggaggaaaaataagccagaagattacgcatgattttgctaaa
gatggttcaaattttgaatttagaattccttaccaaacgtataagaactcacaaaattgt
atagtggaattaagagacttttccatacaagctcataatgattttgataccgtaggtttt
gctcagttgcgattttctccagcaggcagagaatattacaatcgagaggttgatctaaac
tcattgattacagcagataattgcaatagtgatatatttaaaagtataagaaaagagtgg
gcaggagccattggttgtcatttttatgtcgatggaaagaaaaagactaaagatgaagaa
ttcaacgcttacaccatctactacgatttttcgaaattcaataatgacaccgtgattcat
tacgatattttagccggtgaaaactatcggtcagagcctttgtcctcagctcaaaagaca
gcagtggtatctgatgataattaa

DBGET integrated database retrieval system