KEGG   Vibrio cholerae IEC224: O3Y_10075Help
Entry
O3Y_10075         CDS       T01766                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00020  Citrate cycle (TCA cycle)
vci00310  Lysine degradation
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
Module
vci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3Y_10075
  Amino acid metabolism
   00310 Lysine degradation
    O3Y_10075
Enzymes [BR:vci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     O3Y_10075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFC58889
Position
I:complement(2291720..2292934)
Genome map
AA seq 404 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDMVARDEVIVEIETDKVVLEVPAPDAGVLEAIL
EQEGATVLSKQLLARLKPGAVAGEPTQDTPDATEPSPDKRHKASLTEESNDALSPAVRRL
LAEHNLEANQVKGSGVGGRITREDIEAHLAANKAKPAAKAEAPIAALAPVVGRSEKRVPM
TRLRKRIAERLLEAKNNTAMLTTFNEVNMKPIMDMRKQYQDVFEKRHGIRLGFMSFYVKA
VTEALKRYPEVNASIDGDDLVYHNYFDVSIAVSTPRGLVTPVLKNCDTLSLAQIEKGIKE
LAEKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQAAILGMHKIQDRAMVVDGK
IEILPMMYLALSYDHRSIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattctggttccagatttgcctgaatcagttgcggatgccacggttgcg
acgtggcataaaaagccgggtgacatggttgctcgcgatgaagtgatcgttgaaattgaa
actgacaaagtggtgctggaagttccagcacccgatgccggtgttctggaagctattttg
gaacaagaaggtgcgacagtgctttctaaacaactgctggcacgtttgaagccaggcgct
gtagcgggtgaaccaacccaagatactccagatgctactgagccatcaccagataaacgc
cataaagcatcactaactgaagaaagcaatgatgcgctaagccctgcggttcgtcgcctg
cttgctgaacataacttggaagcaaaccaagttaaaggttctggtgtgggtggtcgtatt
acccgcgaagacatcgaagctcacttagccgcgaacaaagccaaaccagctgcgaaagct
gaagcccctatcgcagcgctggctcctgtcgtcggccgcagtgaaaagcgcgtgccaatg
acacgtctgcgtaagcgtatcgctgagcgtctgttggaagcgaaaaataacacggctatg
ctgacgacgtttaatgaagtgaacatgaaacctatcatggacatgcgtaagcaataccaa
gatgtgttcgaaaaacgtcatggcattcgtctgggctttatgtcgttctacgtgaaagct
gtcactgaagcgctgaagcgttacccagaagtgaacgcgtctatcgatggtgatgatctg
gtttaccacaactactttgatgtgagcattgccgtatcaaccccacgtggtctggttact
ccagtactgaaaaactgcgataccttgagtttggcgcaaattgaaaaaggcatcaaagag
ctagcagaaaaaggtcgtgacggtaaattgaccgtagacgaactgactggcggtaacttt
accatcaccaacggtggtgtgtttggttcactgatgtcaacgcctatcattaacccgcca
caagcggcgattctgggtatgcataagatccaagaccgcgccatggtggtggatggcaag
attgaaatcctgccaatgatgtatctagcgctgtcttatgaccaccgttcaatcgatggt
cgtgagtcggttggtttcctagtgaccgttaaagagttgctagaagatccagcccgtctg
ctgctcgatgtttaa

DBGET integrated database retrieval system