KEGG   Vibrio cholerae O1 IEC224: O3Y_11705Help
Entry
O3Y_11705         CDS       T01766                                 

Definition
(GenBank) inorganic phosphate transporter, PiT family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    O3Y_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 OST3_OST6
Motif
Other DBs
NCBI-ProteinID: AFC59211
Position
I:2667022..2668284
Genome map
AA seq 420 aa AA seqDB search
MEILANYGTVLIIVAAVFGFLMAIGIGANDVANAMGTSVGSKALTVKQAIIIAMIFEFAG
AYLAGGEVTETIRNGVIETSLFADKPDVLIYGMMSALLAAGTWLLVASYMGWPVSTTHSI
IGAIIGFACVSVGTEAVDWSSVKGIVGSWIITPVISGFFAYLIFVSAQRLIFDTEKPLIN
AKRFVPVYMFITTMVIALVTIKKGLKHVGLHLSSSEAWMWSAVVSAIVMVGGYLYIQKKF
ANRDEDHGFAGVESIFSILMVITACAMAFAHGSNDVANAIGPLSAVVSTVEHMGEVAAKS
SIAWWILPLGGFGIVVGLATLGHKVMATIGTGITELTPSRGFAAQLATASTVVLASGTGL
PISTTQTLVGAVLGVGFARGIAALNLGVVRNIVASWVVTLPAGALLAVVFFYAIQAVFVG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccttgcgaactacggcaccgtcttgattattgtggcagctgtcttcggtttc
ttgatggcgattggtattggtgcaaacgatgttgccaatgcaatgggcacttcagtaggt
tcaaaagcactcaccgttaaacaagccattattattgcgatgatttttgaattcgcaggc
gcttacttagccggtggtgaagtgacagaaacgatccgtaatggggtgattgaaacctct
ctcttcgcagataaacccgatgtgctgatttacggcatgatgtcagcgcttcttgccgca
ggcacttggttactggtggcgtcttacatgggctggccagtctctaccactcactctatc
atcggcgctattattggtttcgcgtgcgtttctgtcggtacagaagcggtcgattggagc
tcagtaaaaggcattgtcggcagttggattattactccggtgatttcaggcttctttgcg
tacctcatttttgtcagcgcacaacgcctcattttcgatacagaaaaaccgctgatcaat
gccaagcgtttcgtaccggtatacatgttcatcaccactatggtgattgctctggttacc
atcaaaaaaggtcttaaacacgtcggcctgcatctttcgagctcagaagcttggatgtgg
tccgcggtggtttctgccatcgtgatggtcggcggctatctctacattcagaagaaattt
gctaatcgcgatgaagaccatggtttcgcgggtgtggaaagcatcttcagtatcctgatg
gtgatcaccgcgtgtgctatggcttttgcgcacggctcaaacgacgtagcgaacgcgatt
ggtcctttgtctgcggtggtttcaaccgttgaacacatgggtgaagtggccgcgaagagc
tctatcgcatggtggattcttcctctgggtggttttggtatcgtcgtcggtctcgcaaca
ttaggtcacaaagtgatggcaaccatcggtactggcattacagaattgacgccaagccgt
ggttttgcagcccagctagcaaccgcttcaaccgtcgtactggcgtcaggcacaggctta
ccgatttcaactacgcaaactctggttggtgcagtactaggtgttggtttcgcacgtggt
attgctgcactgaacttaggtgtggtacgtaacatcgttgcctcttgggtcgtcactcta
ccggcaggcgcactcttagccgtggttttcttctacgcgattcaagcagtgtttgtcggc
taa

DBGET integrated database retrieval system