KEGG   Vibrio cholerae IEC224: O3Y_13185Help
Entry
O3Y_13185         CDS       T01766                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vci  Vibrio cholerae IEC224
Pathway
vci00071  Fatty acid degradation
vci00280  Valine, leucine and isoleucine degradation
vci00281  Geraniol degradation
vci00310  Lysine degradation
vci00362  Benzoate degradation
vci00380  Tryptophan metabolism
vci00410  beta-Alanine metabolism
vci00640  Propanoate metabolism
vci00650  Butanoate metabolism
vci00903  Limonene and pinene degradation
vci00930  Caprolactam degradation
vci01040  Biosynthesis of unsaturated fatty acids
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
vci01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3Y_13185 (fadB)
   00650 Butanoate metabolism
    O3Y_13185 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    O3Y_13185 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    O3Y_13185 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3Y_13185 (fadB)
   00310 Lysine degradation
    O3Y_13185 (fadB)
   00380 Tryptophan metabolism
    O3Y_13185 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3Y_13185 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3Y_13185 (fadB)
   00281 Geraniol degradation
    O3Y_13185 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3Y_13185 (fadB)
   00930 Caprolactam degradation
    O3Y_13185 (fadB)
Enzymes [BR:vci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     O3Y_13185 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3Y_13185 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     O3Y_13185 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     O3Y_13185 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFC59507
Position
I:2988623..2990794
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
TETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQSFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQV
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagcgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaagccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttatcagcgttaaaaggccatacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggcgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagcgttaaaa
gtgggattactggatgcgattgtcgatagcgacaaactgatcgattccgcaatcaccact
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactctaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacacttcatcaagctc
gcaaaatctaccgaggcacaagcgctggttggtattttcctcaatgatcaatacatcaaa
ggtctagccaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggcggcggcatcgcctatcaatcggctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagaactgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggtttcaaaatggctggcattctggct
tccatcaccccttctctgcattacgctgggattgatcaggcggatgtgattgttgaggcc
gtggtggaaaatccgaaagtaaaagccgcggtactgagcgaagtggaaggattggtcgat
acagaaacaattctgacctccaacacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccatcaaccgagtggttgct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgattgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgcaaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggcccggcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggcggaaggc
ttcccaactcgcatggcgaaaagcggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggcaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaagctttgacccacaaacccttattgaacgcactatgattccgatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtattccgttacttagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagtc
agtgccctgtaa

DBGET integrated database retrieval system