KEGG   Vibrio cholerae O1 IEC224: O3Y_13588
Entry
O3Y_13588         CDS       T01766                                 

Definition
(GenBank) hypothetical protein
Organism
vci  Vibrio cholerae O1 IEC224
SSDB
Other DBs
NCBI-ProteinID: AFC59540
Position
II:23394..26651
AA seq 1085 aa
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWK
GQFSIKQRSYTLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSK
GESKSCLLYPAQHTLSIGYAHQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHA
HFAQYLEDYVADIGTPAEQDIFKDTCTPSLPVEKSEEAVKGTEFKFVADKAVVSSSDYLQ
DLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGDETQQHKMQMAELTRTLGRIR
LEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSGNYALMQQQAE
QKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSF
DSPKNLMALASTGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDER
IQEKAWFKRWIEPVQSSFGALQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRL
LLVESLVREEAVLQHNPKYAAELKQFETKLNAILQEMNDALELKPGNVSPKNHQIATAQS
AQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALSKNVKTSSASVSQKLGGLGGL
LFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGAISAGRAWVTI
AEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLI
GVILTNVFKRSELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQW
MDSGSLQWQLELTLPDYLKGQTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIED
NQPVYRITLGGSEKDTVGVCVALPLRWGKELSLKFYASGTRAGELDLQSAEANDIATRNL
VVGKG
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgagtaatcccaatcaagctgcgaaaacaggacagaccaatgatgcgcaaaatcccgcc
agtgcatgtccttttaaacagccgttaatagggataattcctgttcgttacgcctttgat
gtttatgatgatcaaggtcaagcattacatcctttacccaaagcggatcgacagtggaaa
ggtcaattctctatcaagcagcgcagttacactttaaggcaactgcgtgatggctggctc
tatgtctatgatgaaacagcaaaaacactgcacgaatatgaagtcgttggctgcaagttg
accaaaattgattggtctgatgatgaggcaaacaaacccactcacgagcgcggttcgaaa
ggtgaaagcaaaagctgtttactctatcccgcccagcacacgctctctatcggttatgcg
catcaacgatggacgtggcgagtgtgtgagcatatgcgctccaataccagcagccgtcat
gctgtgatgcgtaaagtgagccttaaacagtttgagtccaatggtactcaccctcatgca
cattttgctcagtatcttgaagactatgtggcggacatcgggacgccagctgagcaggat
atttttaaagatacctgtaccccttcattaccggtagagaaaagtgaagaagcggtgaaa
ggtacggaattcaaattcgttgccgacaaagcggtggtaagcagcagtgattatttgcaa
gatttgccggagcaaaactgcggtttatttgtggcgctgaatgaccctttagcggatgtg
tcagatttatttgttacttttactacccaagtggcaaagcgaactaaagcgattggtgat
gaaacgcaacagcataaaatgcagatggcagagctgacacgcacattaggccgaattcgt
cttgaagaaaaagaaattcccgattttgtaaaacaagatccgatccgtattttagagcta
gaaagagccattactgaatattgtgctacggcaaaattggccgaaatcgaatctcatcat
ttagccagtgaagggcattccccatcgggaaactatgccttgatgcagcagcaagcggag
cagaaactggcggaattgaaaacactctatcgctttgaacccaccagtgctcagatgcgc
aagtggcgcaaaaaagacaacagctttattgatgaagtgcgttgggcggatttagataac
tttttggtggagcattacaccgagctcaaaggattggatgaacagattaaacaacactat
gcgcagtttatgtctgccttcaaccagctcggccttgacccgcttctgtttggtatggat
aaccaagatgaggttcagcaagcgtatttgttagcattaactagccaatttttagtggtg
gttacgcaagtcaatcatgatgaaaaatcgcttgagatcctaaaaaaagatctcagtttt
gattcaccgaaaaacctcatggccctcgcgtcaacaggcttttccctgcaggcaaatcaa
gccattaacaaccatatccaagggtttagcaccgcttttctctctacaagtaatcctagt
gatatggtggcgtttgcgaccgcaatcgctaactgggatacgttcacgggggatgaacgt
attcaggagaaagcatggtttaagagatggattgaacccgttcaatcgagttttggtgca
ctgcaaaaagcggtcgccaatcaagccaaagagagttggcaagcggtgatggagttgctg
tttccttatcagaatcagcccaaaggagggacgcccagtttgttggctaaccttcgttta
ctgttggtggaaagcctagttcgagaagaggcggtgctgcaacataaccccaagtatgcg
gctgagcttaagcaatttgagactaagctgaatgccattttgcaagagatgaatgatgct
ctggaactcaaacccggtaatgtgagcccgaaaaaccatcaaattgcgaccgcgcaatcc
gcacaacgtaagctagggcaattactcagtagtgagctgccgatgatgctgacgctcaaa
aaccaagctgcgatgaacacttttcagcagtcggtaaatgagaaactgagcgcgctatcg
aaaaacgtcaaaaccagtagcgcgtcggtgagtcagaaactgggtggattagggggcttg
ctgtttgcgttgaacctatggaataccatgacggttttggagaatatccgctataaggtc
gcacaataccccagttggaatccttttaagaacccggcgttgggcgaagccatttatgcc
actggcaacactattgtagtcgccggtgccattagtgctgggcgagcttgggtgacgatt
gctgagcaagggttgttagatcgtacactgaaaaacgccttaaataccacgaaagttttg
ggcacaaaagatgccctaaaaacctttgctaaatcgatcgccttggtggctaccgtgggc
atgattgccagcgcattagaaacatgggaaagctggggtaagtttaatgacagcagtaaa
accgatcttgaacgcttcggttatttgttaaaagctggagcaacgggagcacagggaatt
attttttatattcagtttttcacactcttaggtagtggaattggtggaccctccatagct
gcgatttctgcaggttggatgctcgccggttttgctgtgattggtattgtctatttgatc
ggggtgattttgaccaatgtgtttaaacgctcagagttagaaatttggttatcaaaatcg
acgtgggggaaagagagtgctcattggccagtgggcaaagaattgaccgagttagagcac
cttctccatcgtccgagtcttcggttgagtcaagttacgcaacgtaaagcagcgcaatgg
atggattcaggttctttacaatggcagttggaactcacgttacccgattatcttaagggg
cagacgataggcttacaaatcacccgtttgccagcgcagccggcatattatcaaccgcaa
agggaggcggtaacaccaatactcatcaatgaacaacagggcaaatggagtattgaagat
aatcagccagtgtatcgtattacactgggtggcagtgagaaggatactgtcggagtttgc
gttgcactgcccctgcgttggggcaaggagctgagcctcaaattctatgccagtggaact
cgcgcgggggaattggatttacaatctgcagaggcgaatgatattgccacaagaaatctc
gttgtaggaaaaggttaa

DBGET integrated database retrieval system