KEGG   Vibrio cholerae O1 IEC224: O3Y_13973Help
Entry
O3Y_13973         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_13973
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_13973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AFC59617
Structure
PDB: 

Position
II:116834..117340
Genome map
AA seq 168 aa AA seqDB search
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctagttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgccacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgcccttaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaagctgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system