KEGG   Vibrio cholerae O1 IEC224: O3Y_13978
Entry
O3Y_13978         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_13978
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_13978
SSDB
Motif
Pfam: VipB VipB_2 DMP12
Other DBs
NCBI-ProteinID: AFC59618
Structure
PDB: 
5MXN 5MYU

Position
II:117384..118859
AA seq 491 aa
MSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVN
KSLVDQMLVELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTK
DELLEDFEFAPETAQSGLYKHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGAL
GAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESPKYTKWRSLRESEDARYLGLTAP
RFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFAFATRLTDSFAKYRWCPNIIGP
QSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMRKGSDNAAFFSA
NSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLER
ELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANF
ELSLVGRLDQA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctacgactgaaaaggtattggaaaggccacagcttgctcaaggcagccttcttgat
gaaattatggcgcaaacccgtatcgcaccaagcgaagagggttacgacatcgcgaaaaaa
ggtgttgcagcgtttatcgaaaatcttatgggttcacaacactctgctgagcctgtcaac
aaatctctggttgaccaaatgttggttgaactggataaaaaaatcagtgcacagatggat
gaaatcctgcacaactcacaattccaagcgatggaatcggcgtggcgcggtttgaagctg
ttcgtggatcgcactgattttcgtgaaaataacaaagtcgaaatccttcacgtaaccaaa
gatgaactgctggaagatttcgagtttgctccagaaacggctcagtccggtctttacaag
cacgtttattctgccggttatggtcaatttggtggcgaacctgttggcgcgatcattggt
aactatgcgtttaccccttcaacgccagatatgaagctgctgcaatacatgggcgcactg
ggtgccatggcgcatgctcctttcatttcaagcgtaggtcctgaattctttggtatcgac
tccttcgaagaactgcctaacattaaagatctcaagtcgacatttgaaagcccgaaatac
accaaatggcgttcactgcgtgaatcggaagatgctcgctatcttggtttgactgcgcct
cgtttcctgctgcgtgttccttacgatccaatcgaaaatccagtgaagtcgttcaattat
gcggaaaacgtcagtgcttcgcacgagcactacctgtggggtaacacggcatttgccttc
gcaactcgtttgacggatagctttgctaaatatcgctggtgtccaaacattatcggtcca
caaagtggtggtgcagttgaagatctgccggtgcatgtctttgaatctatgggtgcattg
caaagcaagatcccaaccgaagtcctgatcacggaccgtaaagaatttgaactggcggaa
gaaggttttattgctcttactatgcgtaaaggcagtgataacgcggcgttcttctctgca
aactccattcaaaaacctaaggttttcccaaataccaaagaaggcaaagaagcggaaacc
aactacaagttgggtacccagttgccgtacatgatgatcatcaaccgtttggcgcactat
gtgaaagttctgcaacgtgagcagatcggtgcttggaaagagcgtcaagatcttgagcgt
gaactgaactcatggatcaaacaatacgttgctgatcaagagaacccacctgcagacgta
cgtagccgtcgtccacttcgtgctgcgcgcattgaagtgatggatgtggaaggcaatcca
ggttggtatcaggtgtcgctctcggttcgtcctcactttaagtacatgggtgcgaacttt
gagttgtcattagttggacgtcttgatcaagcctga

DBGET integrated database retrieval system