KEGG   Vibrio cholerae O1 IEC224: O3Y_13983Help
Entry
O3Y_13983         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein
  KO
K11905  type VI secretion system protein
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_13983
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_13983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AFC59619
Position
II:118862..119299
Genome map
AA seq 145 aa AA seqDB search
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAP
HLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITAT
INSEALHEKVQFSLLLDQSRKYRVF
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacatcgcacctgaagagagtgcatttggtgttggctttttcgaacgtttggaa
gccaacgccaaacctatgtcgctgacccgtgggccagacgcgtgggatgtactcgaatcg
atcaaacggaatgtctctaacattctgaacactcgaattggtggagcgcaaagtgcccct
catctcgggttggtggattttaatgatgcaacgctggaaaccttagatctctccgtgcga
attaaattggcgattcaacagtgccttgagcgctatgagccgcgtttaactcgcgttctg
gtgagagcggatcaagatagctttaacccgctgactttaaggttccacattaccgcgacc
atcaatagcgaagcgttacacgaaaaagtccagttcagtctgttattggatcaaagcaga
aaatatcgagtgttttaa

DBGET integrated database retrieval system