KEGG   Vibrio cholerae O1 IEC224: O3Y_13998
Entry
O3Y_13998         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpI
  KO
K11894  type VI secretion system protein ImpI
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_13998
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   O3Y_13998
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: AFC59622
Position
II:122057..123544
AA seq 495 aa
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEV
MMVDGAYCLKDSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQY
GSLDALFASKDEDLLADLTLDIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQ
PLSAQPSLVPQDNLVLQNADFTPQADSEYEMTSSIRLKKILGFAKATFAKQTKSEAPNVT
SATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQPQLEKSAYSTMHTSSTSQANH
LVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSESRFGTLNRNL
QPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIF
EQAYDRKIREKQLEL
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaactcagtgacattaccttcgttgaccctattagtcaccaatgctcagcacttagag
tctggcttgtccgctcagcatacgtggacctcgtcaggtggggtgatcggctcatcgccg
aatgcgcagtggcgtttggtcgatgcgcaaggcagtgtaaaacccatgcactgtgaagtg
atgatggtagacggggcgtattgtttaaaagacagctgcggcagcacgtatgtcaacggg
gcagacatgccactgggcgttgggcaaatggcacgtctgactcacaaagatgaagtgagt
gtggggccttaccgtttgcgagtgctgtttggtaacgccatcgaagtggaagaacaatat
ggatctttagatgcgctgtttgcctctaaggatgaggatctgctagcggatttgacgctc
gacatcgaaccagaaaaacacgaattaccaaccaatacagacccattacaggcgctcgat
aacctgatgggtgcggcgggcagttcgacctccttactggatgatcctaaaagtgagcag
ccgttatccgcccaacctagcctcgtgccacaagataacttagtgctgcaaaatgccgat
tttacgccacaagcggacagtgagtatgagatgacctcatcgatccgccttaagaaaatt
cttggttttgcgaaggccacctttgctaagcaaaccaaatcagaagcaccgaacgtgact
tctgccacccccacaatttctcaatataaaaccagcgaaagcaacgtatcagagggcttc
acaatggatgaaaaagtactggatttgttagaagaggaagtcgcgaaaagtttccaaccg
cagttggagaaaagcgcgtattccactatgcacacaagctcaaccagccaagctaaccac
ttggtgacaggtccgatcttggaagggctcggcgtagatctgagcgatgaaaatgatatg
aatcgtatgcatcttttatcgcaagagttgggtgagtctttgcaagcttgtgtgcgcggt
ttactcgatttgcatcaacaagtgagtgaaagccgtttcggtactttgaaccgtaatctg
caacccattgaagataacccgctgcgtttaggtctctcctatgaagagacgatccgcact
ctgtacgatgccgacaagagcgtcgtgcacctttctgcccctgcggcgattgctgaaagc
ctaaaaaccgttcgcgatcataatgaagcgatgcagttcgccacgtcagaagccttgagc
caaattctcaacgctttctcaccacaggtgatgctgcgccgtttccaccactacaagcgc
aattctgataccacacaaacttcaacggatgcttgggcgtggaatatgtactgcagctac
taccaagagctgacctctaaccgccaacgcggctttgagaagttgttctgggagatcttt
gagcaagcctacgatcgcaaaattcgcgagaagcaactggagctataa

DBGET integrated database retrieval system