KEGG   Vibrio cholerae O1 IEC224: O3Y_14008
Entry
O3Y_14008         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_14008
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_14008
SSDB
Motif
Pfam: T6SS_VasE GMP_synt_C
Other DBs
NCBI-ProteinID: AFC59624
Position
II:124030..125364
AA seq 444 aa
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRI
AIERAVGVMPDGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERG
TGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSV
VLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQA
LNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQP
LIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRR
LFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtttgcgcgtaaccgagtgatctggaatgaagggctatttattaagccgcaacatttc
cagcaacagcagagatatacggagtactgcctagacgagcgcctgagcaccgtgagccgt
tacttgtatgggatttccgagttgtcgctcaacccggaatacctctcgtttggccgtatt
gcgattgagcgtgcggtcggcgtgatgcccgatggcaccacctttcgtattcctcaagaa
gatcatcttcccgatgcgctcgaagtgaccgatgcgtcattggcaaaccagattgtctac
ttagccgtaccgctacgtagtgagtcgctgatggagattaactggccagaagagcgtggt
acggggcgctatgtcagccgtcgtctcgaagtgcgtgatgtccatagcgtgcagggtgat
accacgacgattgatgtttcccctgtgcgtttgcaactcatgcttgagcgagaggatcgc
agtgcgtatgcctcaattgctattggccgtattttagaaaaacgtcctgatggcagcgtg
gtgctcgatccggatttcatcccttgtcacttgaatgtagtgggcatctctgcgctgcac
cgctttattaatgagatgtcaggcctgatgcgtgagcgagcgaaaaatattgctcagcgc
atcagctctccagcacaaggtggggttgctgatgtttcggactttatgctgctgcaagct
ttaaaccgtctgcaaccacaaatgaagcatttggcagagctgcgcagcttacacccagag
cgtctgtttgaatgtctctcgtgtgtgtgtggtgagctggctacctttactgacgaaagt
cgtctgccgcccagtttgccaagctataaccatgattcacccagccactctttccagccg
ctgatccgcagcttgcgtcagagcttgagcgtggtgctagagccgcgtgccgtctctatc
caactggataaacgtaagtacggtttgatggttgcgccaatccatgatccgcaactgatg
gagagtgcagagtttatcatcgcggttaaagctcgcatgccgttggatgagctacgccgt
ctgtttactcagcaaaccaaagtggcatcggttgagaaaattcgtgaactcatctcactg
caactgccgggtattccattgacgccattacccgtcgcaccgcgccaattgccttaccac
gctggctacacctactaccaactggataaaaccagcgctgcatgggcgatgttgactcat
tccagcggttttgcgttccacgttgctgcagcttttgacgatcttgagctgcaattctgg
gctatcaggagctaa

DBGET integrated database retrieval system