KEGG   Vibrio cholerae O1 IEC224: O3Y_14013Help
Entry
O3Y_14013         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpK
  KO
K11892  type VI secretion system protein ImpK
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    O3Y_14013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_14013
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_14013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: AFC59625
Structure
PDB: 

Position
II:125367..126140
Genome map
AA seq 257 aa AA seqDB search
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECD
NIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHS
MLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREK
VISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY
VLHSKSSDVLNQLNQIL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagagtaaaaaagagacgccattagccagtttgttgttcgacgatgtggaaaaa
attaaccacgaccaagactactggttccaattgcgtggggacaatccgaatgtgctgatt
gatgccgcgacacccttgtttgggctttctctgcgggttcgtaccctcaccgaatgcgac
aacattgaacagatctaccgtcagacgattgaagagatcaaagcgattgaaattgagttg
acggagcaaggttacgaacacgccattttgatggcctatcgctacatcttgtgcgccttt
ttggatgaatccgtgatgggaaccgagtggggcgcgtccagtttatgggccgagcactcc
atgctgtcacgcttccataatgaaacgtggggtggcgagaaagtgtttacgattttgagc
cgtcttgagggtgaaccacaccgttaccaagcgctattggcctttatttatcattgcctg
attttgggctttgaaggcaaataccgtgtgatggaagggggacaagctgagcgcgaaaaa
gtgatcagccgcctgcatcaactgctgagcagcttggaagagagcgagccacaagactta
acccgtccgaccgatcatgtggtgcgtgcgaaatataccctaagcagacagatgcctgtt
tggtctgtgtttgctggctttatcgtgctttgggtaggtctatttctcggctacagctat
gtactgcatagcaaatccagcgatgtgctcaatcaactcaatcaaatactttaa

DBGET integrated database retrieval system