KEGG   Vibrio cholerae O1 IEC224: O3Y_14038Help
Entry
O3Y_14038         CDS       T01766                                 

Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    O3Y_14038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_14038
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_14038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AFC59630
Position
II:132503..136003
Genome map
AA seq 1166 aa AA seqDB search
MVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAVWGIWQ
WRKLQAFKSEQKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLG
LENAGKTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRS
EENDGALERRLWLHFVDWLDRTRSRRPLNGIVLALDVAHLATATASERKAYANLLRARLR
ELMETLSTRLPVYIALTKLDLLHGFEPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLEEF
ASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFTRQISGLKEILQQFFQEALASDQFST
SALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNSTVYFTQKLFTHIIYP
EAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKVNQYKE
QFPTSRSLASQREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNL
LETRFLPLLMADTIVALNQAETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFS
GQRQIQEELLGHLDYAMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQVELGSMPNDQRV
YRNLKLSAQTVLGPSVNLRSLIGPVFDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQSE
SVSELALIDSWVLGQSKTAQFSEADKQALREKIRDLYVADYTNTWRAALNEIDVKYFNDI
NDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELLKSPKYKVASMIETPF
ADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLVNADPI
YTLKRISSGLPKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFN
PASNKDVALADFEAFFAPNGTLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQ
AQKIREAFFNRKGILDVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGPRENVELIWPNTL
RDSAVSKVTLIPTQTNMSPRSLQIQGPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEMIY
RINAEADANPFTERLFKSFKLSKTLY
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcagcacttcccattttgctattcactacgttcattttgctgaacgttgccatt
tggtgggcaggcccttggttagaagtggctggctataaaccgctggagtcgatcatggct
cgagttgtggcaagcagtctgtttactctcggctgtttagccgtgtggggcatttggcag
tggcgtaagttgcaagccttcaaatcggagcaaaagcgcgaagagcaactgcgccaagat
ccgatcaaggtgtatgagcagcgccaagaggttgaactgaatcaggtgatgctcaatatg
aagcagagcctaaataaacacaactacttgtatgcactaccttggtatttggttctaggt
ttagaaaatgcgggtaaaaccagcctgatcaaccgttctggtcagaactttgtcttctct
tcggtcatgcgagcttcgggacaaaaaagcgaaaacccatactcgtttgattggtggatt
ggtgatgaatctgtcctgattgatcctgatggtgagctgttaacgcaaggcaatcgtagt
gaagaaaatgatggtgcgttagagcgccgcttatggttgcattttgtcgattggctagac
cgcactcgtagccgccgcccgttaaacggcatcgtgttggcgttggatgtggcgcatctt
gctaccgccaccgcctcagagcgtaaagcttatgccaatttgctgcgtgctcgtctgcgt
gagttgatggaaaccttatcgactcgtctgccggtgtacattgcactgactaagctcgac
ttactgcacggttttgagcctttctttaagcactacaccaaaagtcagcgcgaagaggtg
ttgggttttaccttctcaatggattcggtagataacctagattcatggttggaagagttt
gccagtgagtacactcaatttgtgtcacgagttaatggcatgctgccgcatgcggtcgca
gcgccaatgacgcttgaagaacgtaacgcgatttacagcttcacgcgtcaaatctcaggt
ttgaaagagattttgcaacagtttttccaagaggctttggcgagcgatcaattctcaacg
tcagcgctggtgcgtggtgcctatttcacgtcggtttaccaacaaggtgtacctaccaac
gcttttgatgatgcggcttcccgtcgttatggtctgtctcatgcgattaatacggcgcag
cgcgcgaaaaactccacggtctatttcacgcaaaaactgtttacccacatcatttatcct
gaagcgggtttagcgtcggataatttccgggttgcaaaaaacaaacgccgtttgatgggg
ctctcttttgtcgcatgctcagtggcgactttgctgttggcgggaacttggcatcgtaac
tacctcaataacgtgcaacacgccgatactgtattaaccaaagtgaatcagtataaagag
cagttcccgaccagccgttcattggcctcacaaagagaggtattggatccgttgaacaag
atccgtgaggcgacactggagtttggtttcttccgtgataaacctcagtacatctccgat
tttggtctctaccaagggcacaccattggcccgaaagtagaagagacctacttaaactta
ctcgaaactcgcttcttgcctctgttgatggcggacaccattgttgcgctcaatcaagct
gagacagatgaagaaaaattagcggtgctgcgtgtgtatcgcatgctggtcgataaaagt
ggtcgttaccaagactatgtgatggattattttgcgaagtattggcaaaaatccttctca
ggtcagcgtcaaattcaggaagagctgctcggccacttagattacgcgatgcgtcatacg
gacctcactgcagagaggctcaatggtgataaaggggcggagcaggtgatgcgcccttac
gataaagtgattgctcgtgctcaggttgaactgggttcaatgccaaacgaccagcgcgtc
tatcgtaacttgaaattgagcgcacaaacggtgcttggtccttcggttaacttgcgtagc
ttgattgggccggtgttcgatgtggtgtttgaagagcgcgttcttaacagtagcagcctg
tttattcctcaaatgctcaccaagcgtggttttgatgactactttatgccgcaatctgaa
tcggtctctgagctggcactgattgacagttgggttctgggacagagcaaaacggcacag
tttagtgaagcagacaagcaggcactgcgcgaaaaaatccgcgatctttatgtggcggat
tacaccaacacatggcgcgcggcactcaatgaaattgatgtgaagtatttcaatgacatc
aatgatgcggtcatggttttggaaaatatcaccagtaaccttgagccgatgcagcgtcta
ctgcgcacattagatgacaacacccaactgtacagtgcgttacctaaagatgaatcggcg
ttaaaagagctgctgaaaagtccgaaatacaaagtggcttcgatgattgaaactccgttt
gctgatctgaacggtatgctcaaaccggtgggcagcaaaccagcgtacatgacggaagtc
ttggcttcggtggatgagctgaaaagctacttgaaatcgattcaagatgctcccgatgtc
ggtatggcggcgctcgatgcgaccaaagcgcgggtcaaactggttaatgctgaccctatc
tataccttaaaacgtatctcgtcaggactgccgaagccgctggatagcatgatggcaaag
cttgcagatgagagctggtatgtggtcaagcaagaagcgatcaagcatctggaagttcgc
tggacggaggatgtgtataaaaccttccaaagcaagctggctgggcgttatccattcaac
cccgcatcaaataaagatgttgccttggccgattttgaagccttctttgcgccgaatggc
acgttagacaacttctacaatcagcaactgaagatgtttattgatgagaacatcagcgtc
gcgtcggatgactcagcgcagtcgatcattcgtaaagaagtgctggatcagatcaagcaa
gcgcagaaaattcgtgaggctttcttcaaccgtaaagggattttggatgtcagcttctcg
gttgagccgctcagtttgagtaacaacaagcgtcgtagtgtgctgaatgtggatggtcag
ttcttagcttacagccatggtccgcgtgaaaatgtggagctgatttggcctaacacgctg
cgtgattctgcggtgtctaaggtgaccttgattccaacccaaaccaatatgtcaccgcgc
agtttgcaaatccaaggaccgtgggcattcttccgcttattggatcaaggtgatgtggtt
tcggcgagtcaaacgtcggttgatttcaaatttatcgtcgatggcggtgagatgatctac
cgtattaacgcagaggccgatgccaacccatttaccgaacgcctgttcaagtcgttcaaa
ctgtctaaaacactctattaa

DBGET integrated database retrieval system