KEGG   Vibrio cholerae O1 IEC224: O3Y_14043
Entry
O3Y_14043         CDS       T01766                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
vci  Vibrio cholerae O1 IEC224
Brite
KEGG Orthology (KO) [BR:vci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vci02044]
    O3Y_14043
Secretion system [BR:vci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   O3Y_14043
SSDB
Motif
Pfam: ImpA_N Cytochrom_B562
Other DBs
NCBI-ProteinID: AFC59631
Position
II:136054..137316
AA seq 420 aa
MSNVIFIGNLCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACN
QGMDFLICGYYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARV
VQELKALKPTYESLRDLYRAERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQY
HSLLKKQEKAQPPKLKFWQRGYALFTLGVLGVALGMVGGYWGWPWFYTTPYAAPQRITTL
NEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTISFSEPKRHAITQLNLLRTLYP
ENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKWAELEKQTKSLE
EFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALLQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtccaatgtgatttttattggtaacctttgctaccgattaaccaatgattctgaggag
attcgcggattagagccctatgcgaaggttcgtgaggagataaaccgccgcttcaatccg
attgctgggggcacggattgggcagtggtaaaagagtactgtgaacaactggcctgtaac
caaggaatggattttctgatctgcggttactatgcggtagcctgcctgaaaactcagggg
ttagcggggtatgccaccggtatggagctgatgagtgcaagccttgccaaccaaggtgag
tgtgatgtgaaaagcgccaaagtgcgcaaagagatccttgattgggtcaatgcacgtgtg
gtgcaggaactgaaagcacttaagccaacttatgagtcgctgcgagatctgtatcgggct
gagcgccattgcgagcggttacatcagctgtttgaacagcaacaaaccgaatacaaagta
gactttgaaggggtcgggtttgctctgtttgaacacatagacagaattgaaacccaatac
cacagcttattgaaaaagcaggagaaggctcagccacctaagcttaagttttggcagcgc
ggttacgcgttgttcactctaggtgtactcggggttgcactgggaatggtggggggctac
tgggggtggccttggttttataccacgccttatgccgcgccacagcgcatcactacgttg
aatgaggcctctcaaactcaagcactgctcaacgactcttccacaagtgagcgtgcgcgt
tggcaacatgatctgatcccgctgtatcgcgatactttgcagcagaatttaaccatctcg
tttagtgaacctaagcgacatgccatcactcagctgaatctattgcgcactctttatcct
gaaaacgagcaagtgaatgcactgagtcaagagtttgcccttcagcagcaacaagcgttg
gagcaaaccgcgctgttcgtggctaagttcagcgaaattcgcaccaaaatggccaatatc
tcgttattggctaagcgagggaaatgggctgagttagaaaagcagaccaaatcattagaa
gagttcgcggtcagcctatcaccgatttatggtcgagttgactatgtgcaaggcctcctt
gaacagggcgatgtcacaaatgcccagaaagagtttgcgatcctcaaacaaaggctagat
agcctaagttggaaaattgccgagcttgagcagcgtatcggcgatgcggctttgttgcag
tga

DBGET integrated database retrieval system