KEGG   Vibrio cholerae O1 IEC224: O3Y_16768Help
Entry
O3Y_16768         CDS       T01766                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vci  Vibrio cholerae O1 IEC224
Pathway
vci00071  Fatty acid degradation
vci00280  Valine, leucine and isoleucine degradation
vci00310  Lysine degradation
vci00362  Benzoate degradation
vci00380  Tryptophan metabolism
vci00620  Pyruvate metabolism
vci00630  Glyoxylate and dicarboxylate metabolism
vci00640  Propanoate metabolism
vci00650  Butanoate metabolism
vci00900  Terpenoid backbone biosynthesis
vci01100  Metabolic pathways
vci01110  Biosynthesis of secondary metabolites
vci01120  Microbial metabolism in diverse environments
vci01130  Biosynthesis of antibiotics
vci01200  Carbon metabolism
vci01212  Fatty acid metabolism
vci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3Y_16768
   00630 Glyoxylate and dicarboxylate metabolism
    O3Y_16768
   00640 Propanoate metabolism
    O3Y_16768
   00650 Butanoate metabolism
    O3Y_16768
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O3Y_16768
   00072 Synthesis and degradation of ketone bodies
    O3Y_16768
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3Y_16768
   00310 Lysine degradation
    O3Y_16768
   00380 Tryptophan metabolism
    O3Y_16768
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O3Y_16768
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3Y_16768
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O3Y_16768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vci04147]
    O3Y_16768
Enzymes [BR:vci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O3Y_16768
Exosome [BR:vci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3Y_16768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC60170
Position
II:complement(627924..629129)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system