KEGG   Vibrio cholerae O1 MJ-1236: VCD_001690
Entry
VCD_001690        CDS       T00903                                 
Name
(GenBank) transcriptional (co)regulator CytR
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcj03000]
    VCD_001690
Transcription factors [BR:vcj03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VCD_001690
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_Tnp_ISL3 HTH_Crp_2 ClpB_D2-small
Other DBs
NCBI-ProteinID: ACQ59859
Position
1:749616..750623
AA seq 335 aa
MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEEAVLEAGYSPNSLARNLRRNESK
TIVAIVPDICDPYFSEIIRGIEDAAMEHGYLVLLGDSGQQKRRENSFVNLVFTKQADGML
LLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDNLTSAFEAVNYLTQLGHKRIA
QISGPQHAALCQFRHQGYQQALRRAGITMNPTYCTFGDFTFEAGAKAVRQLLALPEQPTA
IFCHNDTMAIGAIQEAKRLGLRVPQDLSVVGFDDIQFAQYCDPPLTTISQPRYEIGRQAM
LMMLELLRGHDVRAGSRLLETKLVVRESAAPPSKK
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggatgttgcccagcttgctggagtttcaaccgcgaccgtgtctcgt
gcgttgatgaatccagagaaagtctcgtcgtccactcgtaaacgagtggaagaggccgtg
ctggaagcgggttactcacccaattctttggcgcgcaatttgcgccgtaatgaatcgaaa
accatcgttgctatcgtgccagatatctgtgatccctacttttctgagatcattcgcggt
attgaagatgccgcgatggagcacggttatctggtgctgttgggggatagtggtcaacag
aagcgtcgggagaactcgttcgttaatctggtgtttaccaaacaggcagacggtatgttg
ctgctggggacagatttgccgtttgatgtgagtaaacctgagcagaaaaacctaccgcct
atggtgatggcgtgtgaatttgcgccagagctggaattgccaacggtacacattgataac
ctgacctcggcatttgaggcggtaaactatctcactcagcttgggcacaaacggattgcg
cagatctcaggtccacaacatgctgcgctgtgccaattccgtcatcaaggctatcaacag
gcgttgcgtcgtgctggcatcaccatgaacccgacttactgcacttttggcgatttcact
tttgaagccggggcaaaagcggtgcgtcagctgttggcattgcctgagcagccgaccgcg
attttctgtcataacgatacgatggcgattggcgcaattcaggaagcgaagcgacttggc
ttgcgcgtaccgcaagatctctctgtggtcggttttgacgatattcagtttgcccagtac
tgcgatcccccattaaccaccatttcgcagccgcgttatgagattggccgtcaagccatg
ctgatgatgcttgagctgcttcgcggacacgatgtacgtgctggatcgcgtcttttggag
accaagctggtcgtgcgtgagagtgctgcgccgccaagcaagaagtaa

DBGET integrated database retrieval system