KEGG   Vibrio cholerae O1 MJ-1236: VCD_002496
Entry
VCD_002496        CDS       T00903                                 

Name
(GenBank) pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00620  Pyruvate metabolism
vcj00640  Propanoate metabolism
vcj00650  Butanoate metabolism
vcj01100  Metabolic pathways
vcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCD_002496
   00640 Propanoate metabolism
    VCD_002496
   00650 Butanoate metabolism
    VCD_002496
Enzymes [BR:vcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     VCD_002496
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACQ60662
Position
1:complement(1618550..1620826)
AA seq 758 aa
MAEQFAKAWEGFAAGDWQNEVNVRDFIQKNYTPYEGDESFLVSEGTEATNKLWAKVMEGI
RQENSTHAPVDFDTSLISTITAHDAGYINKDLEKIVGLQTDAPLKRAIIPNGGIRMVEGS
CKAYGRELDPQVSKIYSEYRKTHNAGVFDIYTPEILACRKSGVLTGLPDAYGRGRIIGDY
RRVALYGIDFLMKDKLAQFKSLQEKFENGEDLQMTMQLREEIAEQHRALGQMKQMAAKYG
YDISRPAETAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSTFLDVYIERDMKAGKITEVEA
QEMIDHFVMKLRMVRFLRTPEYDELFSGDPIWATESMGGMGLDGRTLVTRTNFRFLNSLY
TMGPSPEPNITVLWSEQLPEGFKKFCAKVSIDTSSIQYENDDLMRPDFNNDDYAIACCVS
PMVIGKHMQFFGARANLAKTLLYVINGGVDEKLKIQVGPKMPKITDEVLDFDDVWGKLDH
FMGWLATQYVTALNAIHYMHDKYSYEAALMALHDRDVRRTMACGIAGLSVAADSLSAIKY
AKVKPIRDEDGVAIDFEIEGDYPKFGNNDSRVDDIACELVERFMNKIRSLKTYRNAVPTQ
SILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAVASLTSVGKLPFAHAKD
GISYTFSIVPNALGKDENSQRANLAGLMDGYFHHEAGIEGGQHLNVNVLNRDTLLDAVKH
PEKYPQLTIRVSGYAVRFNSLTAEQQQDVIARTFTESL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcagagcaatttgctaaagcttgggaaggttttgcggcaggtgactggcaaaacgaa
gttaacgttcgtgattttattcaaaagaactacacaccgtacgaaggcgacgaatctttc
ctagtctcagaaggtactgaagcgaccaacaagctttgggctaaagtaatggaaggtatc
agacaggaaaactcaactcacgctcctgttgacttcgacacttctcttatctctaccatc
acagctcacgacgctggctacatcaacaaagatcttgaaaagatcgttggtctacaaacc
gatgctccactgaaacgtgcaatcatccctaatggtggtatccgtatggtggaaggttca
tgcaaagcatacggtcgtgaactggatccacaagtttcaaaaatctactctgaataccgc
aaaacgcacaacgccggtgtattcgacatctacactccagaaattctggcttgtcgtaaa
tctggcgttctgactggtcttccagatgcttacggccgtggtcgtatcatcggtgactac
cgtcgtgtagcgttgtacggtatcgacttcctgatgaaagacaaactggctcagttcaag
tctctgcaggaaaaatttgaaaacggcgaagatctgcaaatgaccatgcaactgcgtgaa
gaaattgcagaacaacaccgtgcgcttggccaaatgaaacagatggctgcgaaatacggt
tacgatatttctcgccctgctgaaacggcacaagaagcaatccaatggacttacttcggc
tacctagcggcagtgaaatctcaaaacggtgctgcaatgtctcttggccgtacctctact
ttcttggacgtgtacattgagcgcgacatgaaagccggcaagatcactgaagtagaagct
caggaaatgatcgaccacttcgtcatgaagctgcgtatggttcgtttcctacgtactcct
gagtacgatgagctgttttctggtgacccaatttgggcaaccgaatctatgggtggtatg
ggtctagacggtcgtacgctggtaacacgtactaacttccgcttcctgaactcactgtac
accatgggtccatctccagagccaaacatcactgtcctgtggtcagagcaactgcctgaa
ggcttcaagaagttctgtgcgaaagtgtctatcgatacctcgtctatccagtacgaaaac
gatgacttgatgcgtcctgacttcaacaatgatgactacgctatcgcatgttgtgtatca
ccaatggttattggtaaacacatgcagttcttcggtgctcgcgctaaccttgctaaaacg
ctgctgtatgtaatcaacggtggtgtggatgagaaactgaaaatccaagtgggtccaaaa
atgcctaagatcaccgacgaagtgctcgacttcgacgatgtatggggcaagctggatcac
ttcatgggttggctggcaacacaatacgtcactgcactgaatgccatccactacatgcat
gacaagtacagctacgaagcggctctaatggcgctgcatgaccgtgatgtacgtcgtact
atggcgtgtggtatcgcaggtctgtctgtagcggctgactcactgtctgctatcaagtac
gcgaaagtaaaaccaattcgtgacgaagatggtgtagctatcgattttgaaattgaaggc
gactatccaaaattcggtaacaacgattcacgcgttgatgacatcgcctgtgaactggtt
gagcgtttcatgaacaagatccgttcactgaaaacttaccgtaacgcagtaccaactcag
tctatcctgactatcacgtcaaacgtggtatacggcaagaagacaggtaacacgccagac
ggtcgccgtgcaggtgcgccatttgcaccgggtgcaaacccaatgcacggccgtgacgag
aaaggggcggtagcgtctctgacttccgtcggtaaactgccatttgctcacgcgaaagac
ggtatctcttataccttctctatcgtgccaaatgcactgggtaaagatgagaactcacag
cgtgcgaacctagctggcttgatggacggttacttccaccacgaagcaggcatcgagggt
ggtcaacacctgaacgttaacgttctgaaccgtgacactctgcttgatgcagttaagcat
ccagagaagtacccacaactgactatccgtgtatctggatatgcagtgcgctttaactct
ctgactgctgaacaacaacaagacgttattgctcgtactttcactgaatctctataa

DBGET integrated database retrieval system