KEGG   Vibrio cholerae O1 MJ-1236: VCD_000137
Entry
VCD_000137        CDS       T00903                                 

Definition
(GenBank) uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcj02044]
    VCD_000137
Secretion system [BR:vcj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCD_000137
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACQ62105
Structure
PDB: 
5MXN 5MYU

Position
2:complement(156170..156676)
AA seq 168 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctagttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgccacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgcccttaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaagctgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system