KEGG   Vibrio cholerae O1 MJ-1236: VCD_000215
Entry
VCD_000215        CDS       T00903                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCD_000215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcj02044]
    VCD_000215
Secretion system [BR:vcj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCD_000215
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Phage_Mu_Gp45 DUF2345
Other DBs
NCBI-ProteinID: ACQ62183
Position
2:complement(251010..253094)
AA seq 694 aa
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQM
VDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQK
QTVPEILSILLQEMGIHDYAFALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHE
AGKHTLYFSDASDSLSKLPEPIPYNALAGGTMDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNE
PLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYNNQFSLIPGHL
HWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHN
QHLTVEGESRTLVKLDCSSEIGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIK
AGGSFIKVDAGGVHVVGSAINLNSGGSAGSGSGYGGKMAELPQGVDKAKTPQEIELAAVT
PTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggcgacattagcgtacagcattgaggtggaagggctggaagatgagactctggtggtc
agaggctttcacgggcaggagtcactctccaacagtgtttttttagggcaagcctgttac
gggtttcgctatcaaatgcaactggcgagtcgggtatccaatctgactgccgaccagatg
gtcgataagcgtgctgagctcaagctttaccgcaactcacaattggtgcagcgtgtgcac
ggcattgtacgtgcctttagccaaggcgatatcggccatcaccacaccttctaccaactc
actttagtgcctgccttagagcgcttatccctgcgccacaatagccgcattttccaaaag
cagactgttccagaaattctctctatcttgctgcaagagatgggcatccacgattacgct
tttgcgctcaaacgtgattgcgtgcagcgtgagttttgtgtgcagtaccgtgaaagtgat
atcgactttctgcaccgcctcgccgctgaagaaggcttggtgtacagctttgtccatgaa
gcgggcaaacataccctctatttcagtgatgccagtgacagcctaagtaaactgccggag
cccatcccgtacaacgccttagcgggcggcacgatggatacaccgtacatccacggctta
acctatcgcacccaagcggaagtgagcgaagttcagctcaaagattacagcttcaaaaag
ccggcgtactcgtttttacaaaccgtgcagggtactgagctggattatcagcaaacgcgc
taccaacattttgatgcgccggggcgctacaaagacgatgtgaacggcgccgcctttagc
caaatccgtttagactacctgcgccgccatgcccacaccgcaacagggcagagcaacgag
ccgctgctgcgtgccggctataagtttgacctgcaagagcatcttgaccctgcgatgaac
cgcgattgggtggtggtctctattaaccatcaaggtgagcagccgcaagcgttacaagaa
gagggcggcagtggtgcaacgacctacaacaaccagttcagcttaattccagggcatctc
cactggcgcgccgagccacaacccaaaccgcaagtcgatggtccaatgatagccacggtc
gtcggtcctgaaggcgaagaaatcttctgtgatgaacacgggcgggtgaaaatccatttt
ccgtgggaccgctactcgaacggtaacgagcaaagctcctgttgggtacgggtgtcgcaa
ggttgggcgggcagtcagtatggctttatcgctattccgcgcatcggtcatgaagtgatt
gtttctttcttaaatggcgacccagaccaaccgattatcactggccgcacctatcatgcg
accaatacgccgccatacactttgccagagcacaaaaccaaaaccgtgctgcgcaccgag
acgcaccaaggggaagggtttaacgagctcagttttgaagaccaagcgggcaaagagcaa
atctacctgcatgcgcagaaagacttcgatggtttgattgaaaacgaccacaccacggtc
attcgccacgaccaacacctgaccgttgaaaacgaccagttcactcagattaagcacaac
caacacctgacggtcgagggggagagtcgtacgctcgtcaaactcgactgcagcagcgaa
atcggcggttcattgcagcaaaaaatcggcagcaaagcgatttacgatgcaggcacagag
gttcaccttaaagcgggtaacaaactggtcttggaagcaggcaacgagcttaccatcaaa
gccggcggcagttttattaaagtcgatgctggcggtgtgcacgtcgtcggctctgctatt
aacctcaactccggcggcagcgcaggcagcggctcaggctatggcggtaaaatggccgag
ttgccacaaggggtggataaagccaaaacgccgcaagagattgagctagccgcggtaact
cccactcagcagtctatgtcgcctttacttaaggcgcgacaaattgaagcactcaaaggt
cctgcacctgtgtgtgaagtgtgtgaagaggccaagggaaattaa

DBGET integrated database retrieval system