KEGG   Vibrio cholerae O1 MJ-1236: VCD_000635Help
Entry
VCD_000635        CDS       T00903                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00071  Fatty acid degradation
vcj00280  Valine, leucine and isoleucine degradation
vcj00310  Lysine degradation
vcj00362  Benzoate degradation
vcj00380  Tryptophan metabolism
vcj00620  Pyruvate metabolism
vcj00630  Glyoxylate and dicarboxylate metabolism
vcj00640  Propanoate metabolism
vcj00650  Butanoate metabolism
vcj00900  Terpenoid backbone biosynthesis
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01130  Biosynthesis of antibiotics
vcj01200  Carbon metabolism
vcj01212  Fatty acid metabolism
vcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCD_000635
   00630 Glyoxylate and dicarboxylate metabolism
    VCD_000635
   00640 Propanoate metabolism
    VCD_000635
   00650 Butanoate metabolism
    VCD_000635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VCD_000635
   00072 Synthesis and degradation of ketone bodies
    VCD_000635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCD_000635
   00310 Lysine degradation
    VCD_000635
   00380 Tryptophan metabolism
    VCD_000635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VCD_000635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VCD_000635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCD_000635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcj04147]
    VCD_000635
Enzymes [BR:vcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VCD_000635
Exosome [BR:vcj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCD_000635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACQ62595
Position
2:730796..732001
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system