KEGG   Vibrio cholerae O1 MJ-1236: VCD_000685Help
Entry
VCD_000685        CDS       T00903                                 

Definition
(GenBank) oxygen-insensitive NAD(P)H nitroreductase/dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00633  Nitrotoluene degradation
vcj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    VCD_000685
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     VCD_000685
  1.-  
   1.-.-  
    1.-.-.-  
     VCD_000685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Cas_Csy1
Motif
Other DBs
NCBI-ProteinID: ACQ62645
Position
2:787725..788282
Genome map
AA seq 185 aa AA seqDB search
MVRMSASSVNSQPWHFILAGSDEGKTRIAKATQGGFSFNERKILDASHVMVFCAKTSIDD
AYLLSLLDNEDKDGRFANEEAKTGMHGARSYFVNLHRENLNDAEHWMQKQVYLNVGTLLL
GAAAMGIDAVPIEGFDAQVLNEEFGLTEKGFNSVVIVPLGFHSEDDFNAKLPKSRWPAEA
VFTEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttggtacgcatgagtgcctctagcgtgaactcacaaccttggcattttattttggccggc
agtgatgaaggcaaaacacgcattgccaaagctacgcagggcggtttttcgtttaatgag
cgcaaaattttagatgcctcgcacgtgatggtgttctgcgccaaaaccagcattgatgac
gcgtatctgctctctctgctggacaacgaagataaagatggccgttttgcgaatgaagaa
gccaaaaccggcatgcatggcgcgcgtagctactttgtaaacttgcaccgtgaaaacctg
aacgatgctgagcactggatgcaaaaacaagtttacctcaacgtgggtacactgctgctt
ggtgctgcagccatgggcattgatgcggtgccgattgaaggctttgatgctcaagtgcta
aacgaagagtttggcttaaccgaaaaaggcttcaacagtgtggtgattgtgccactaggt
ttccacagtgaagacgacttcaacgccaaactgcctaaatcacgttggccggcggaagcg
gtctttaccgagctgtaa

DBGET integrated database retrieval system