KEGG   Vibrio cholerae MJ-1236: VCD_001679Help
Entry
VCD_001679        CDS       T00903                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00010  Glycolysis / Gluconeogenesis
vcj00030  Pentose phosphate pathway
vcj00051  Fructose and mannose metabolism
vcj00052  Galactose metabolism
vcj00680  Methane metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01130  Biosynthesis of antibiotics
vcj01200  Carbon metabolism
vcj01230  Biosynthesis of amino acids
vcj03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCD_001679
   00030 Pentose phosphate pathway
    VCD_001679
   00051 Fructose and mannose metabolism
    VCD_001679
   00052 Galactose metabolism
    VCD_001679
  Energy metabolism
   00680 Methane metabolism
    VCD_001679
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VCD_001679
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VCD_001679
Protein phosphatases and associated proteins [BR:vcj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VCD_001679
Messenger RNA biogenesis [BR:vcj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VCD_001679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACQ59848
Position
1:736910..737878
Genome map
AA seq 322 aa AA seqDB search
MSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVFGIYDGYQGLYEDRIKQLDRSSV
SDVINRGGTFLGSARFPQFREVEVREKAIENLKKHGIEALVVIGGDGSYMGAKKLTEMGF
PCIGLPGTIDNDIAGTDYTIGYLTALNTVIEAIDRLRDTSSSHQRISIVEIMGRHCGDLT
LTSAIAGGCEYIITPETGLNMEQLISNIKDGIAKGKKHAIIALTELMMDANKLAKEIESA
TGRETRATVLGHIQRGGKPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIQKEQLVHHDII
DAIENMKRPVRTDLYKVAEELF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgattaaaaaaatcggtgttttgacgagtggtggcgatgccccaggtatgaat
gcagctattcgcggcgtggtgcgtacagcacttggcgcaggtttagaagtgtttggtatt
tacgacggctaccaaggtctgtacgaagatcgtattaagcagctagaccgttcaagcgtg
tctgacgtgatcaaccgtggcggtacttttttaggctctgcacgcttcccacaatttcgt
gaagttgaagtgcgcgaaaaagcgattgaaaacctgaaaaagcacggcattgaagcgctg
gttgtgattggtggtgacggctcttacatgggcgccaaaaaactgaccgaaatgggtttc
ccttgtatcggtctgccaggcacgattgataacgatatcgcgggcaccgactacaccatc
ggttatttgactgccctgaacaccgttattgaagcgattgaccgtctgcgcgatacctct
tcttcacaccaacgtatctctatcgtagaaatcatgggtcgtcactgtggtgacttgacg
ctgacctctgcgattgcgggtggctgtgaatacatcatcacaccggaaacgggtctgaat
atggagcagctgatttccaatatcaaagatggtattgcgaaaggcaaaaagcacgcgatc
attgcgctgactgagctgatgatggatgccaacaaactggccaaagagattgaatcggcg
acaggccgtgaaactcgcgcaactgtattaggccatattcaacgtggtggtaaacctacc
gcatttgaccgtgtactggcatcgcgcatgggtaactacgcggtgcatctattgatggaa
ggtcacggtggtcgttgtgtgggtatccagaaagagcaactggttcaccacgacatcatt
gatgcgattgaaaacatgaagcgtcctgtacgcactgacctgtacaaagtcgctgaagag
ctgttctaa

DBGET integrated database retrieval system