KEGG   Vibrio cholerae MJ-1236: VCD_001942Help
Entry
VCD_001942        CDS       T00903                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00010  Glycolysis / Gluconeogenesis
vcj00020  Citrate cycle (TCA cycle)
vcj00620  Pyruvate metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01120  Microbial metabolism in diverse environments
vcj01130  Biosynthesis of antibiotics
vcj01200  Carbon metabolism
Module
vcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCD_001942
   00020 Citrate cycle (TCA cycle)
    VCD_001942
   00620 Pyruvate metabolism
    VCD_001942
Enzymes [BR:vcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VCD_001942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACQ60111
Position
1:1009789..1011678
Genome map
AA seq 629 aa AA seqDB search
MAIEIYVPDIGADEVEVTEILVKVGDKVAEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVSTGSLIMVFEAEGAAAAAPAPAPQAAAPVAAAPAAAALKEVQVPDIGGDEVEVTE
IMVKVGDVVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVFEVAGA
APLAAPVQAAAPAAAAAPAVAALKEVQVPDIGGDEVTVTEIMVNVGDSISEEQSLITVEG
DKASMEVPAPFAGTLKEIKVATGDKVKTGSLIMVFEVAGAAPVAAPVQAAAAPAAAPAQA
ATPAAAAPATSGEFQENHEYSHASPVVRRLAREFGVNLAKVKGSGRKNRILKEDVQNYVK
EALKRLESGAQAAASGKGDGAALGLLPWPKVDFSKFGDTEVQPLSRIKKISGANLHRNWV
MIPHVTQWDNADITELEKFRQEQNAMEAKRDTGMKITPLVFIMKAAAKALEAFPAFNSSL
SDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSKELAEVSKKARGGKLTAA
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPVWNGKEFAPRLQLPLSLSY
DHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaatttatgtacctgacatcggtgcggatgaggttgaagtcactgagatt
ctcgtcaaagtcggcgacaaagtggctgaagagcaatctctgatcacggttgaaggcgac
aaagcttctatggaagttcctgcgtctcaagcgggtatcgttaaagagatcaaagtagtg
gcaggtgacaaagtgtctactggctctctgatcatggtctttgaagcggaaggtgcagca
gcggcagcaccagctcctgcgcctcaagcggcagcaccagttgctgcggctccagcggca
gctgcactgaaagaagtgcaagtaccagacattggcggtgatgaagttgaagtgactgaa
atcatggtcaaagtgggcgatgtggttgcggaagagcaatctctgatcaccgttgaaggc
gacaaagcgtcaatggaagtacctgcacctttcgctggtacggttaaagagatcaaaatc
gctgcgggcgacaaagtatcaacaggttcactgatcatggtgtttgaagtagccggcgct
gcgccacttgcagcacccgttcaagctgcggcaccagcggcagctgctgctccggccgtt
gcagcactgaaagaagttcaagtacctgatatcggcggtgacgaagtgaccgtaacggaa
atcatggttaacgtgggcgacagcatcagcgaagagcaatctctgatcaccgtagaaggc
gataaagcttctatggaagtacctgcaccttttgccggaactctgaaagagatcaaagtg
gctacaggcgataaagtgaaaacaggttcgctgatcatggtgtttgaagttgctggcgca
gcgccagtcgcggcaccagttcaagcagcagcagcacctgcggcagcgcctgctcaagca
gcgactcctgcggcggctgcacctgcaacaagtggtgaattccaagaaaaccatgagtac
tcacatgcttctccagtcgtgcgtcgtctggctcgtgaatttggcgttaacctagccaaa
gtcaaaggctctggccgtaagaaccgtatcctgaaagaagacgtacagaactacgtgaaa
gaagcgctgaaacgtctggaatctggcgcgcaagcggcggcttcaggtaaaggtgatggc
gcagcgctgggcttactgccttggccaaaagtggacttcagcaagttcggtgataccgaa
gtgcaaccactgtctcgcatcaagaaaatctcgggtgctaacctgcaccgtaactgggtg
atgatcccgcacgtgacccaatgggacaatgcagacatcactgagctagagaaattccgt
caagagcaaaacgcgatggaagcgaagcgcgacacaggtatgaagatcactccgctggtg
ttcatcatgaaagccgctgcgaaagcgctggaagctttccctgcgttcaactcttctctg
tctgacgacggcgaaagcttgatcctgaagaaatacgtgaacatcggtatcgcagtggat
acaccaaatggtctggtggttcctgtgtttaaagatgtgaacaagaaaggtatctacgag
ctgtcaaaagagctggctgaagtctcgaagaaagcccgtggcggtaagctgactgccgct
gacatgcaaggtggctgtttcactatctctagcctaggtggcattggcggtacagcgttt
accccaatcgttaacgcacctgaagtggctattttgggtgtgtctaagtctgagatgaag
ccagtgtggaacggcaaagagttcgcgccacgtctgcaactgccactgtcactgtcttac
gatcaccgcgtgatcgacggtgcagaaggtgcacgcttcattacttacctgaacgagtgt
ctaagcgacatccgtcgtctggtactgtaa

DBGET integrated database retrieval system