KEGG   Vibrio cholerae O1 MJ-1236: VCD_002586Help
Entry
VCD_002586        CDS       T00903                                 

Definition
(GenBank) transcriptional regulator
  KO
K07733  prophage regulatory protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcj03000]
    VCD_002586
Transcription factors [BR:vcj03000]
 Prokaryotic Type
  Other transcription factors
   Others
    VCD_002586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_AlpA HTH_17 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ACQ60752
Position
1:1711500..1711706
Genome map
AA seq 68 aa AA seqDB search
MGQQDIGEHPMRFLKLKEVMEKTALSRSAIYRKMNDGEFPQSVSLGERAIAWVESEVDEW
MDFCLKQR
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacaagacataggagaacatcccatgagatttctgaaactaaaagaagtaatg
gaaaagaccgcactaagccgttcagcaatttaccgaaaaatgaatgatggcgagtttcca
cagtcggtgagcttgggagaaagggctattgcctgggtggaaagcgaagtggatgagtgg
atggacttttgtcttaaacagcgatga

DBGET integrated database retrieval system