KEGG   Vibrio cholerae O1 MJ-1236: VCD_002603Help
Entry
VCD_002603        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF262 Dynein_attach_N
Motif
Other DBs
NCBI-ProteinID: ACQ60769
Position
1:1735226..1736638
Genome map
AA seq 470 aa AA seqDB search
MAVVVASCTLDKLFSNESILASDGKVQKNVHGMLAIPEYQRPYRWNEEQITRLLKDFKLH
QQELNDKLETEHCPFYLGSVILHQQGDKLNIIDGQQRLTTMALMSYLANKHVDLKLVYES
PESQQQIKHNLGWLYRNEASLADIDFAQINITLVVTDSEDEAYRFFETQNTGGVRLAGPD
IIKAHHLRAVDEKDKSAVNTFATRWEALGDLNPVVDILLRGRYWQYLNFRDYPLHNQTQQ
VRNSIVTELAEHTGKGDDIAFGRIARTYMPNGGESLAQPQVGYELRQPLNSGANTIHYLQ
YFEQLRQTYLLKNSTQGELAGFYEFYQKLVCKLDGCGYLKQLYDACLLLYISQHGQQSLE
VAAKKLFRVVYSRRVENQKAVKEKSVPAFVKETPVLDWIAMSYTPEQCFAQLDGFKLSVD
KSGFDKNSVKKRFVEKVSQYFGLDIDKQDYANQFGPAFSQHISALGAKHG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgttgttgccagttgcacactggataagctgttttctaatgagtcgatttta
gcttctgacggtaaagttcaaaaaaacgttcacgggatgcttgccatccctgaatatcag
cgtccctatcgctggaatgaagagcaaatcacccgtctattgaaagatttcaagcttcat
cagcaagagttaaatgacaagcttgaaacagagcattgcccattctatttaggtagtgtg
attctgcatcagcagggtgacaagctgaatatcatcgatggtcagcaacgtttgaccaca
atggcgttgatgtcttatctagcaaataaacatgtcgatcttaaactagtttacgaatcg
cctgagagtcagcagcaaatcaaacacaatcttggttggttgtatagaaatgaagcctct
ttggctgatatcgattttgctcaaatcaatattaccttggtggtgacagacagtgaagat
gaagcctaccgcttttttgaaacccaaaacacgggcggcgtgcgattagccgggccagat
attattaaagcgcaccatcttagagcggttgatgagaaagataagtctgcggtaaacacc
tttgccacacgttgggaagcgctgggggatttaaaccccgtggtcgatattttgctacgt
ggtcgctattggcaatatctgaacttccgagactacccgctgcacaaccaaactcagcaa
gtgcgaaatagtattgtcaccgaactggcagagcacacaggcaaaggcgacgatattgcc
tttggtagaattgctcgtacttatatgcccaacggtggagagagcttggcacagcctcaa
gttggctatgaattgcgccagccgctaaacagtggcgctaataccattcactatttgcaa
tattttgagcaactgcgccaaacctatttgctgaaaaactcaacgcaaggtgagcttgca
ggcttttacgagttctatcaaaagctggtgtgtaaacttgatggctgcggctatctcaaa
cagctttatgacgcttgcctgctgctctacatcagtcagcatgggcagcaaagcctagag
gtagcagcgaaaaaacttttccgcgtggtttactctcgacgtgtagagaaccaaaaagca
gtaaaagagaaatcggttcctgcttttgtcaaagaaaccccagtgctggattggattgcg
atgagctataccccagagcagtgtttcgcacagcttgatggttttaagctgtcggtagac
aagagtggctttgataaaaacagcgttaaaaaacgtttcgtcgaaaaagtgtctcaatac
tttggccttgatatagacaagcaagattatgccaatcaatttggccctgcatttagccaa
cacatctctgcgttaggagcaaaacatgggtga

DBGET integrated database retrieval system