KEGG   Vibrio cholerae O1 MJ-1236: VCD_002605Help
Entry
VCD_002605        CDS       T00903                                 

Definition
(GenBank) type I site-specific restriction-modification system R (restriction) subunit-like helicase
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:vcj02048]
    VCD_002605
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     VCD_002605
Prokaryotic defense system [BR:vcj02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   VCD_002605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSDR_N ResIII DEAD UvrD-helicase Mannitol_dh_C USP8_dimer N_NLPC_P60 4HBT_2 HJURP_C
Motif
Other DBs
NCBI-ProteinID: ACQ60771
Position
1:1738650..1741718
Genome map
AA seq 1022 aa AA seqDB search
MVFMVSKTNEQALEAAIEKGLAGICKEELALGEAPLNYNNDLYLIGSPSDFDKQYALDTR
LFWQFLEDTQASELEKLKRTSPHDWQRKILERFDRMIKRHGVLRLLKKGLDVDDAFLSLM
YPAPLASSSEKVKKDFSANLFSVTRQVCYSNANPLEEIDMVLFINGIPLITLELKNPWTG
QNAVYHGQKQYRDDRDANQPLLNFARCLVHMAVDTDEVYMTTKLAGKNTFFLPFNKGFNF
GKGNPINPHGHKTAYLWQEVFRKESIANIIQHFIRLDGSSKKQLDKRTLFFPRYHQMDVV
RRLVDHCSVNGVGQTYLIQHSAGSGKSNSITWAAYQLIETYPISDDLPGSRGKEMPLFDS
VIVVTDRRLLDKQLRDNIKEFSEVKNIVAPAFKSSELKSALENGKKIIITTIQKFPYIVD
GIADLSDRRFAVIIDEAHSSQDGHNQDKLNEAMGFVSEDVLDKALQSAKNRKMRSNASYF
AFTATPKNTTLEKFGQRQADGTYVPFHLYSMKQAIEEGFILDVIANYTTYKSYYEIEKSI
QDNPEFDSKKAQKRLRAYVEASQETIDTKAEIMLEHFIKHVVNGKKLKGKGKGMVVTQNI
ESAIRYYRALTRQLNKMGNPFKVAIAFSGSKEVDGIEYTEADINGFPEGDTKDYFDVNYK
RKEPDSPIPKHVDQDAYRLLVVANKYLTGFDQPKLCAMYVDKKLASVLCVQALSRLNRSA
PKYGKKTEDLFVLDFFNSVDDIKTAFDPFYTSTTLSEATDVNVLHELKDDMDDTDVYEWF
EVEEFNKRFFEGREAQDLSPIIDIAAARFNHELELENEFKVDFKVKAKQFVKIYGQIASI
MPYEVVQWEKLFWFLKFLIPKLSVEDPDKEALDSLLDSVDLSSYGLQRVKLNHSIELDDS
ETELDPQNPNPRGAYGPEAEKDPLDEIIKIFNERWFQGWSATPEEQRVKFVNIAESIRNH
PDFEAKYQNNADPHTRELAFEKMLKEIMLQRRKDELELYKLFAQDPAFKASWTQSMQRMV
GM
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
gtggtatttatggttagtaaaacaaatgaacaggcgctagaggccgcaatcgaaaaaggt
ttagcaggtatttgtaaagaagagttagcgctgggtgaagcgcctcttaattacaataat
gatctttatcttattggctctccaagtgactttgacaagcagtacgctttagatacccgt
ttgttttggcaattcctcgaagatactcaagcgagtgagttagaaaaacttaagcgcacc
agccctcacgattggcagagaaaaatccttgagcgtttcgatcgtatgatcaagcgccat
ggtgttttgcgactattgaaaaaagggctagacgttgacgatgcctttctatcgttgatg
tacccggcaccactcgccagtagttctgagaaggtaaaaaaagatttttctgccaacctg
tttagtgtgactcgccaggtttgttattccaatgcaaatccattggaagaaattgacatg
gtgctttttatcaatggtatccctctgattacccttgagcttaaaaacccatggacgggc
cagaacgctgtttatcatggtcaaaagcagtaccgcgatgatagagatgcaaatcagcca
ttgttgaactttgctcgttgcttggttcacatggcggtcgataccgatgaagtctatatg
acgactaagctggcaggcaaaaataccttcttcctgccgttcaacaaaggcttcaacttt
ggcaaaggtaacccgattaatccacatgggcacaagacggcctacttgtggcaagaggta
ttccgcaaagaaagcatcgccaatattattcagcactttattcgtcttgatggcagcagt
aaaaagcagttggacaaacgaactttgttcttccctcgatatcaccaaatggatgtcgta
cgtcgcttggttgatcactgctcagttaatggtgttgggcaaacgtatttgatacagcac
tcagcggggtcaggtaaatctaactcaattacatgggcggcgtatcagctcatcgaaact
taccctattagcgatgatctaccaggaagtagaggaaaagaaatgcctctattcgattcg
gtcatcgttgttactgaccgccgattgctcgataagcagttacgcgacaatataaaagag
ttctctgaagtgaagaacattgttgcgcctgcgtttaaatcgtcagaactaaagtcagca
ttagagaatggtaagaaaatcatcattaccaccattcaaaagtttccctatattgtcgat
ggtattgcagacttaagtgataggcgctttgctgtcatcattgatgaagcacacagttcg
caggatgggcataaccaagataagttaaatgaagcaatggggtttgtttcggaggatgtt
ttagacaaagcattacaaagtgcgaaaaatcgtaagatgcgctcaaatgcatcttacttt
gcattcaccgcaacgcccaaaaacaccactctagaaaagtttggtcagcgacaagcagac
ggaacttatgttccttttcatttgtactcgatgaaacaagccatcgaagaagggtttatc
ctcgatgttattgccaattacacgacctataagagctactacgagattgaaaaatcaatc
caagataaccctgagtttgacagcaaaaaagcacagaagcgcttacgagcgtatgtagag
gcaagccaagagacgatagacactaaagccgagatcatgcttgagcatttcatcaagcat
gtcgttaacggcaagaagctaaaaggtaaaggcaaaggtatggtggtgactcaaaacatt
gagtcagccatacgttactatcgggcactaaccagacagctcaataaaatgggcaatccg
tttaaagttgccattgcattctctggctcaaaagaagtcgatgggattgagtacacagaa
gctgacattaatggtttcccagaaggtgataccaaagattactttgatgtgaactacaag
cgtaaggagccggactctccaatccctaagcacgtagaccaagatgcttaccggttgctg
gtagtggcgaataagtatttaacaggctttgatcagccgaaactttgtgccatgtacgtg
gataaaaagttggctagcgttttgtgtgtccaagctctgtcacgcttaaaccgttcagcg
ccaaagtacggtaagaaaacggaagatctgtttgtgttggatttcttcaactcagtggat
gatatcaaaaccgcattcgaccctttctatacatccacaacgctttctgaagcgacagat
gtcaatgttcttcatgagctaaaagatgatatggacgacacagatgtttatgagtggttt
gaagttgaggagttcaacaagcgtttctttgaaggacgagaggctcaggacctaagccca
atcattgacatcgcagctgcgcgttttaaccacgagttagaactagagaacgagtttaaa
gtcgatttcaaagtgaaagccaagcagtttgtgaaaatctacggccagattgcatctatc
atgccttatgaggtcgttcagtgggaaaaactgttctggttcttgaaatttttgattccg
aagctttccgtcgaagacccagataaagaagcactagactcattactagattcagttgat
ttgagctcttatggattacaaagggttaagcttaaccattccatcgagctagatgactct
gaaactgagttagatcctcaaaacccgaacccgcgcggggcttatggtcctgaagctgag
aaagatccgttagatgagatcatcaaaatctttaacgaacgctggttccaaggctggagc
gcaacaccagaagagcagagagttaagtttgtgaacattgctgagagcatccgaaatcac
ccagatttcgaagctaaataccaaaacaacgcagaccctcatacgcgagagttagcgttt
gaaaagatgttgaaagaaatcatgcttcaacgtcgtaaagacgagttagagctctacaag
ctgtttgcccaagacccagcttttaaagcgtcttggacgcagagcatgcagcgtatggtt
gggatgtaa

DBGET integrated database retrieval system