KEGG   Vibrio cholerae O1 MJ-1236: VCD_002606Help
Entry
VCD_002606        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein MotA_ExbB DUF4092
Motif
Other DBs
NCBI-ProteinID: ACQ60772
Position
1:1741763..1743883
Genome map
AA seq 706 aa AA seqDB search
MTDSLNLSSLWPDLSSLNVMPPQTPEQLSALFVVILWGVALFFLIWSVAAFIRARQRVVW
LNKSLDDAEKSTLSGVRNDLISRAEQKKDSVGHLWLEFDETLLEVKGADDVVRLHNTFDA
DYFFNSSSLAGGSTENRMIAVVPGFLTALGVIGTFVGLQLGLSDLNIAGNVDVNEMKNGV
AGVINGAKIAFMTSVWGVLLSVAFNFIEKILEQIIRKKIKSLQNRIDRMFPRLSAEYQLQ
SIANNSQQSRESLQGLAEKIGEKMQESLIQATQGIQQGLESSLEKIMAPAINKLVDETSD
GNQKALESVLQSFMEGFGQQGEQQRVAMDSASQNVNKTLESMSVSMAAFVNKLEVQQNAS
SEREKELISTISVQVSELVTQGNEQKRVLTEFVEKQVSELGEQLTKRELAASEREQKLAS
SMESTIKDLVENVSAQSQVLTDFVQNQVVQLTQTFSERDGMASQMEKERNDIFVNQTQAM
KAGTDELLAQVKAATESQQITTNSIIEQGKQLQNSIDSSVSASARATESMQQSANELRVA
ADSMNVFGSNIKDAGNKLSGAVTEAVNSTKDLAEQNHLGAVKVQALREQLLEDTSKFSAI
ADQINNMLISAEQSFSTLRTTQNEFLAEQKGNLNELTSEMKRNVKELTEQMAQLLEDYAE
QANGQTAEHLKVWANSSTQYAESMNTAVRAISSVVDEIQDKVSQHA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatagccttaatctttccagtttatggccagacttgagcagtctaaatgtaatg
ccacctcaaactcctgagcaattgagtgctttgtttgtggttattttatggggtgtcgct
ctatttttcttaatttggtcagttgctgcatttattcgcgcaagacaacgagtagtttgg
cttaacaaatctttggatgatgcggagaaatcgactctgtcaggtgttcgaaatgattta
atttctagagctgaacaaaaaaaagattcagtagggcatttatggctcgagtttgatgaa
acattgcttgaagtaaaaggtgctgatgacgttgttcgattgcataacacatttgatgct
gactatttttttaatagttctagtttagctggtggtagtactgaaaacagaatgattgcg
gtggttccaggctttttaacggctctgggtgttattggtacttttgtcggtttacagcta
ggactttcagatctcaatatcgcgggcaacgttgatgtcaatgaaatgaaaaatggcgtt
gctggagttataaatggtgcaaaaatcgcatttatgacatcggtttggggcgtgctactc
agtgttgcatttaatttcattgagaagatacttgagcaaattattagaaagaaaattaag
tctttgcaaaaccgtattgacaggatgttccctcgattaagtgcggaatatcaactgcaa
tctattgcaaataacagccagcaatctcgagaaagcctacaaggacttgctgagaaaata
ggcgagaaaatgcaggagtcactcattcaggcaactcagggtattcaacaaggtctcgag
agtagtctggaaaaaatcatggctccggctatcaataagctcgttgacgaaacatctgac
gggaatcaaaaagcactggaaagcgttcttcaatctttcatggagggttttggtcaacaa
ggcgaacaacaacgtgtcgcgatggactctgcgtctcaaaacgtaaataagacgctagaa
tcaatgagcgtttcgatggctgctttcgtcaataagttggaagttcagcaaaacgcatct
tcagaaagagagaaagaactgatctcaactatttcagttcaagtttctgagctagttact
cagggtaatgagcagaagcgtgttctaacagagtttgtagaaaaacaagtctcagagtta
ggtgagcagcttactaaaagagaattagctgcttctgaacgtgaacagaaattggcttcc
tcaatggaaagtacgattaaagatttagtagaaaatgtttcagcacaaagccaagtcttg
accgattttgttcagaatcaagttgtccaacttacccaaacgttctccgaacgagatgga
atggcaagtcagatggaaaaagagcgtaatgatatatttgtgaatcaaacgcaggcgatg
aaagctggaacggatgagcttcttgctcaagtgaaagcggcgactgaatcacaacaaatc
acaactaatagtattattgagcaaggtaaacaattacaaaatagtatcgattcctctgtt
tcggcatctgctcgagctacggagagtatgcagcagtcggcgaatgagttacgagttgcc
gctgatagtatgaatgtgtttggttccaacatcaaagatgcgggcaacaaactatctggt
gctgttactgaagcggttaacagcacgaaggatttagcggaacaaaaccatctaggcgca
gtgaaagttcaagcgttgagggagcagttgctggaagatacaagtaagtttagcgcgatt
gcagatcagataaacaatatgctgattagtgcagaacagtcgtttagcacgcttcgtact
acccaaaatgagttccttgcagaacaaaaaggtaatctaaacgaactcacttcagaaatg
aaacgtaatgtgaaagagttgacggagcaaatggctcaactgcttgaagattacgcagag
caagccaatggacaaaccgccgagcacctcaaagtttgggccaatagtagcacacaatat
gcagagagcatgaatacagcagttagagctatttctagtgttgtcgatgaaattcaagat
aaagtgagccaacatgcgtag

DBGET integrated database retrieval system