KEGG   Vibrio cholerae O1 MJ-1236: VCD_002607Help
Entry
VCD_002607        CDS       T00903                                 

Definition
(GenBank) chemotaxis protein MotB-related protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA MotB_plug
Motif
Other DBs
NCBI-ProteinID: ACQ60773
Position
1:1743876..1744610
Genome map
AA seq 244 aa AA seqDB search
MRRGVRSHTQNSVDEENPYWVSFSDLMSALLVIFILAAVALIIELTQKTNDVEAGIEELK
QAELARKNIIYDVRDELAKRNVIVEIADNDTVIRIPESTLTFASGKSSIPNDATIQQAVK
DIGVVLHSAIQKKDRFQYLDTIFIEGHTDSDSIHYRGKGNWGLSTDRAISVWNVWQNELS
LTPKLGDLENAYHAKLFSVSGYAATRRANLHEANQQEKSQNRRIDIRFTVKKPSIAELER
IVGP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaggtgttcgttcgcatacacaaaactcagtagatgaagaaaatccctactgg
gtttcattttccgatctaatgtctgctttgcttgttatatttatacttgcagctgttgct
ctgattattgaattaactcaaaagaccaatgatgtcgaagctggtattgaagagcttaag
caagctgagttagcaagaaagaatataatttatgatgttcgagacgaactggctaaaaga
aacgtaattgttgaaattgctgataacgatacggtaattcggattccagaaagcacactg
acgtttgcatcaggtaaatcatcaattccgaacgatgcaacaatacagcaagcagttaag
gacataggtgttgttcttcattctgcaattcagaagaaagaccgatttcaatatctcgat
accatttttattgaggggcataccgatagcgatagtatccattacagaggaaaagggaat
tgggggttatctactgatcgagcaatatctgtctggaatgtctggcaaaatgaactgagc
ttaacgcctaaactcggtgacttagaaaacgcttatcatgcaaagctgttctctgttagt
ggttatgcggcgacaagacgtgccaatctacatgaggcgaatcagcaagaaaagagccag
aataggcgcattgatattcgatttacagttaagaaaccatctattgctgagctcgagagg
attgttggaccgtga

DBGET integrated database retrieval system