KEGG   Vibrio cholerae O1 MJ-1236: VCD_002608Help
Entry
VCD_002608        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EH_Signature
Motif
Other DBs
NCBI-ProteinID: ACQ60774
Position
1:1744607..1746058
Genome map
AA seq 483 aa AA seqDB search
MSLNIKKLKVSLPANPFGQAIKDFAHLSSQLEVLSKSAGIENNKFRTAYGEVCNALASKK
RVEDVIDSSVHVRALALSLHTDAKKNVSFTRRLLNKITEIVKKPSSLVIESFYQHFLSEY
DRLADLEATADWLLEAKRLRGNDEQFDENILSTNGPKWLAERAIQNNVDFDHLIAEMKLE
RYANGRYLTAAKGIYYIEQLNTIPLGQDHPLLEEVQKTVVFDSRYDSESLLGHQILRILI
GRSIGSHISEPWMNVILAIGGDPRVPSSNPRYIKWWKSLEPNLVQAVLGWLSKLDLKLFL
EALEDYSYSSANYELQRMYPSRKSFLEGMFDAGVISNTRLYLSLDAARYLKRNYDPKHLP
NFSTVKDGDKSIIYVQMNGAHMVEGSHSCYLWLYRYLDPSVCVFNYNIDSPTYSQLTIGI
NNQMSRLSSGAVAKITHSPSGYAWQRKALIALRELGVKLTPKDVLSNEDYIDFKQRYGVR
EWS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctaaatataaaaaagctcaaagttagtttgcctgctaatccttttggtcaagcc
atcaaggactttgcacatctatcgagtcagctagaagtgctttctaagagtgccggtatt
gaaaacaataagttccgaactgcatatggagaagtatgtaatgcgcttgcctctaagaaa
agagttgaggacgttatagatagctctgtacacgttcgcgccttagctctttcgctacat
acggatgcgaagaaaaatgtcagctttacgcgcagattgcttaataaaattacagaaatt
gtaaaaaaaccaagctctttagtcatagagtcgttttatcagcatttcttatcagagtat
gaccgactggcagacttggaagctacagcagactggttgttggaggctaaaaggctgcga
ggcaatgatgagcagtttgatgaaaatatattgtcaaccaatggccccaagtggcttgcg
gaaagggctattcaaaataatgtcgattttgatcatttaattgcggagatgaagctggaa
cgttatgcaaatggcagatatttaacggcggctaaaggcatctactatattgagcagtta
aacactataccattaggccaagatcatcctctcctagaggaggttcaaaaaacggtggtt
tttgattctcgatatgactctgaaagtttgttagggcatcaaattcttagaattttgatt
ggccgatcgataggttctcacatcagtgagccttggatgaatgtgatcttagcaattggc
ggtgacccacgagtaccaagttcaaatccaagatatattaagtggtggaagagtttagaa
ccaaatctggttcaagctgttctcggatggttatcaaaactagacttgaagttgtttctg
gaagcgttggaggattattcttactcttcagctaattacgagctacagagaatgtaccca
tctcggaaaagtttcttagaggggatgttcgatgcgggggttatttcaaatacccggctt
tatttgagtctggatgctgcaaggtatttgaagagaaattatgaccctaagcacttgcca
aatttctctactgttaaagatggtgacaaatcgataatttatgtgcaaatgaacggcgct
cacatggttgaggggagccatagttgttatttgtggttgtaccggtatcttgacccttcc
gtttgtgtgtttaactataacattgatagtcctacgtactcacaactcacaatcggtata
aacaatcaaatgtccagattgtcatctggtgcagttgctaaaataacgcactctccgagt
ggttacgcatggcaacgaaaagcacttatagcactaagagagttaggagttaaattgacg
ccgaaagatgtgctttcgaatgaagattatattgattttaaacaacgttatggggtgcga
gagtggagttaa

DBGET integrated database retrieval system