KEGG   Vibrio cholerae O1 MJ-1236: VCD_002613Help
Entry
VCD_002613        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACQ60779
Position
1:1752971..1753465
Genome map
AA seq 164 aa AA seqDB search
MSQEELKKLVQEEKSLSAEEKLQRALDRLIGKGGKPLRTKVKGRLTLNKINNEAGLGRSY
IHKFKDFVEKVANPAIEKYNASLDDPRQSEQIASESGDMSEINRLRAELNREKELKIEYR
RERDEALAINTKLEILNKSLMFRVYELQEQLSAEVVEFEHHKKS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaagaactaaaaaagctggtacaagaagagaaatctctttccgctgaggaa
aagctccaaagggcattagaccgcctgataggtaaaggtggtaagcctctgagaacaaag
gtaaagggtcgcctaacgcttaataaaattaacaatgaggcaggcttggggcgaagctat
atccataagtttaaggattttgttgaaaaggtcgctaacccagcaatcgaaaaatacaac
gcttccttggatgatcctagacaatcggagcaaatagcttcggagtcaggagatatgagt
gaaattaatagactcagagccgaattaaatcgtgaaaaggaactaaagatcgagtatcgg
cgggagcgagatgaggcgcttgctatcaatactaaactcgaaatattaaataagtcacta
atgtttcgtgtgtacgaacttcaggagcagctttctgccgaagttgtggagttcgagcat
cacaaaaagtcttaa

DBGET integrated database retrieval system