KEGG   Vibrio cholerae O1 MJ-1236: VCD_002619Help
Entry
VCD_002619        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_37 HTH_26 HTH_25 BetR
Motif
Other DBs
NCBI-ProteinID: ACQ60785
Position
1:complement(1763531..1763740)
Genome map
AA seq 69 aa AA seqDB search
MNKKLAALVGKRIAKMRKSKGLTQDKLALFAEIDRSYVGRIERGEVNITIEKLYEIAETL
GCDAKELLP
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaagcttgcagcacttgtgggcaaacgcattgcaaaaatgaggaaatcgaaa
gggttaactcaagataaactcgcgttgttcgcagagatagatagaagttatgtagggcgc
attgagcgcggtgaagtcaatatcacgattgagaagttgtatgaaattgcggagaccttg
ggttgtgatgccaaggagcttctcccctaa

DBGET integrated database retrieval system