KEGG   Vibrio cholerae O1 MJ-1236: VCD_002620Help
Entry
VCD_002620        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve_2
Motif
Other DBs
NCBI-ProteinID: ACQ60786
Position
1:1763847..1764386
Genome map
AA seq 179 aa AA seqDB search
MKVKIRKELFLAIYYNEHFSANDLKSFPLDGDEKEYLSDEYVEKKLKEMSLIGAVLSCGF
DKHGDELFSKGFMFNHTDWEVVDYDNYSEDSNYLSLKKESLLTILQDKQSELSESYSLHK
RTWKHFNRLCTQHSELRACLDEYISEYDNRRLDLKAEMLAVENAITFYKNTAQLEESGS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaagatcagaaaagagttatttctcgccatttattacaatgaacatttctct
gccaatgacttaaagtcgtttccattagacggtgatgagaaagagtatttatcggatgaa
tacgtcgaaaaaaaattgaaggaaatgtcgcttatcggtgcagtcctatcgtgcggtttc
gataagcatggagatgagttgttttccaaaggttttatgtttaaccataccgactgggag
gttgttgattacgacaattacagtgaggattccaattatctttctctcaagaaagaaagt
ctcttgacgattttgcaagataaacagtcagagctgtcagagtcctattctcttcataaa
agaacatggaagcatttcaatcgcttgtgtactcaacactcagaacttcgggcgtgttta
gacgagtatatatccgagtatgacaatcgtagattggatctcaaagccgaaatgctggca
gtagaaaatgcaattaccttctacaaaaacacagcccaactagaagaaagtgggagctaa

DBGET integrated database retrieval system