KEGG   Vibrio cholerae O1 MJ-1236: VCD_002622Help
Entry
VCD_002622        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_15 TrmB Peptidase_C23 MarR
Motif
Other DBs
NCBI-ProteinID: ACQ60788
Position
1:1766116..1766472
Genome map
AA seq 118 aa AA seqDB search
MKAKIGILSEELARKRMIRIAEGKVTSEEPHHQFLFESLAVLSQLLSNENVELLNLIARE
KPNSLDELAEMSGRSIKDVTDAFEALSSKGFACLDVRGMESRPIALFTKFEIVMSSLL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaaatcggcattctatcagaagagcttgctcgtaagcgcatgattcgcatt
gcagaaggaaaagtgacgtctgaagaacctcaccatcaatttttgtttgagtcattggct
gtgctttcacaactgttgtctaacgaaaatgttgagctgctgaatttgattgctcgcgaa
aagccaaacagtcttgatgaacttgctgaaatgagtgggcgcagcatcaaggatgttact
gatgctttcgaagctctttcatctaagggctttgcttgcctggatgtgaggggaatggaa
tctcgaccaatagcgttgtttacgaagttcgagatcgttatgagcagtttgctttaa

DBGET integrated database retrieval system