KEGG   Vibrio cholerae O1 MJ-1236: VCD_002623Help
Entry
VCD_002623        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACQ60789
Position
1:complement(1766739..1766879)
Genome map
AA seq 46 aa AA seqDB search
MRIFPLEFSPFIINCETMMYDKHYYNVHIHWRYIPVGVLALLLVHN
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatctttccattagaattctcaccttttatcattaactgtgaaactatgatgtat
gacaagcactactacaatgtgcacatccattggcgttatatcccagttggcgtgctcgcg
ctactgctggtgcacaactag

DBGET integrated database retrieval system