KEGG   Vibrio cholerae O1 MJ-1236: VCD_002630Help
Entry
VCD_002630        CDS       T00903                                 

Definition
(GenBank) paraquat-inducible protein B
  KO
K06192  paraquat-inducible protein B
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    VCD_002630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaD DUF1489
Motif
Other DBs
NCBI-ProteinID: ACQ60796
Position
1:complement(1776688..1778331)
Genome map
AA seq 547 aa AA seqDB search
MRKLSMSDEPQVNAEITAQKQLSAIWIIPILALAMGLWMLFQYVNSTGPKITLILPTADG
LEVGKTQIKALNVNVGVITEIKLSEDYDHIVATAQMSKDADRMLREDTLFWVVKPRIGRE
GISGLDTLLSGAYIQLQPGTASSAQDHFKVMDLPPIAPPDAKGLRLVLTNKEAGKLNVGD
PVMYEGFTVGRVESAQFDVESKKAQYQLFIFAPYDKLVNTRSFFWLNSGINLQLNAEGLE
FSLGSIESLLKGGVTFGQLQEEDSGQPITQQLTEFRLFDDVKQIREGMFDDYIEFVMMFD
ESVRGLKPSAPVEYRGLRIGTVSKVPLRTRTSNIDISTNRIPVLVRIELGRLYDNFNKAD
LPALKSRMQQEFFKGLKASLKTGNLVTGALYIDTDYYPEEKIDGLKHFDGYPLFPTKQGG
FAEVQKQVTELLRKLNGLPMDDTLASLNSTLKTSEALLASAERILKKQETQNLPADIQAS
LKQLETTLGGFGPESTVYRELETTLRELNQVMAEFKPVLRTINEKPNALIFGESNTADPI
PAKGKQE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactgtctatgagtgatgaacctcaagttaatgctgaaataactgcgcaaaag
cagctctctgcaatttggatcattcctattctggctcttgcgatggggttatggatgtta
tttcagtacgtcaatagcacgggtcccaagataacgctcatcttaccgacagctgatggg
ctcgaagtagggaaaacccaaattaaagcccttaatgtcaatgttggggtaataactgag
ataaaactcagcgaagattacgatcacattgtggcaacggcgcaaatgagcaaagatgcc
gatcgcatgttgcgcgaagatacgctcttttgggtagtaaaacctcgcattggccgagaa
ggcatttctggtctcgataccttactttctggcgcttatattcagctccaaccgggaacc
gcttcgagtgctcaagaccattttaaggtcatggacttaccaccgattgcaccgcctgat
gctaaagggttgcgtttagtgctcacgaataaagaagccggaaaactcaacgtgggcgat
ccagtcatgtatgaaggattcaccgtcggccgagtggagagtgcccagtttgatgtggaa
agcaaaaaggctcagtaccaactctttatctttgccccttacgataaattggtgaataca
cgctccttcttctggctcaattccgggatcaaccttcaactgaatgccgaagggcttgag
ttcagcttagggtcgatagaaagcctactcaaaggcggagtcacttttggccagttacaa
gaagaggattctggccagccgattactcagcagctgaccgagtttcgcttgtttgatgat
gtaaaacagatccgtgaaggcatgtttgatgactacatcgagtttgtgatgatgtttgat
gaatcggtacgcgggctcaaaccttccgctccggtcgaatatcgtggtctacgtatcggt
acggtcagcaaagtacctctgcgtactcgtacctcaaacattgatatcagtactaatcgt
atccccgtcctagtgcgaattgagctaggtcgtttgtacgataattttaataaagccgat
ctccccgcattgaagtcacgtatgcaacaggagtttttcaaagggctcaaagcctcgtta
aaaaccggcaacttagtgactggcgctttgtacattgataccgattattacccagaagaa
aaaatagatggcttgaaacacttcgatgggtatcccctattccccaccaaacaaggtgga
tttgctgaagtgcaaaaacaagttaccgaattgctgagaaaactcaacgggttgcctatg
gatgatactttggcatcactcaacagcacgttaaaaacctcagaagcgctgttggcttcg
gcagaacgcattctcaaaaaacaagagacacaaaatctgccagcggatattcaagcaagc
ctaaagcaactggaaacgaccctaggtggttttggtcctgagtcgacggtgtatcgtgag
cttgaaaccacgttaagagaactcaaccaagtgatggccgaatttaaacctgtgctgcgc
accattaatgaaaaacctaatgccttgatttttggtgaaagtaatacagcagatccgatt
cccgcgaaaggaaagcaagaatga

DBGET integrated database retrieval system