KEGG   Vibrio cholerae O1 MJ-1236: VCD_002631Help
Entry
VCD_002631        CDS       T00903                                 

Definition
(GenBank) paraquat-inducible protein A
  KO
K03808  paraquat-inducible protein A
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    VCD_002631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PqiA Zn-ribbon_8 zinc_ribbon_9 TackOD1
Motif
Other DBs
NCBI-ProteinID: ACQ60797
Position
1:complement(1778328..1779632)
Genome map
AA seq 434 aa AA seqDB search
MTMDKLKNHLIGCDECGLITNVPLLSQAQTAQCPRCGHTLTQTPQKPYQTAVALTISCLI
LLVLSLTFPFMSFSVQGMTQEITLLNAAKMLGEFQNVLLAILLFTTVILFPALYITILLF
VSFKAAQSTQRQLSSSEIQRAKLLCKTLLTVQPWLMVDVFLIGVLVSLIKIASLAEVAMG
YSFWAFCFFAMLVVKTVSLVDRYWLWQHFIPAQTPQGVNAGQTHCTHNSVSCHTCQQINL
LRPDQKKPTCLRCGSRLHAYHPQLNLQWAWALLLAAIIFYIPANLYPMMYTVSLGKSEGS
SIMQGVILLWHLGSYPVAMVIFLASIFIPMAKMFALGWLYWQAGKLNVFPEQQNLKRLKV
YRVTEFIGRWSMIDIFVVAILVSLVQLHNLMAIYPGPAALSFAAVVLLTMLSAMVFDSRI
LWHEPPESPPTKIK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactatggacaaactaaagaatcatttgattggttgtgacgagtgtgggctaataacc
aacgtaccacttttaagccaagcacaaactgcgcagtgtcctcgttgcgggcatacgctc
acccaaacacctcaaaaaccgtaccaaaccgctgtcgcattaaccatcagttgcctgatt
ttattggtgctcagcctgacgtttccttttatgtcatttagcgtgcaaggaatgacccaa
gaaattacgctgttaaatgcagccaaaatgctcggtgaatttcaaaacgttttattagcc
attttactctttaccaccgttatcctttttccggcgctctacatcaccatacttcttttt
gtctcttttaaagccgcgcaaagcacacaacgacaactttcttcatccgagatccagcgc
gcgaagctattgtgcaaaacattactcacagttcagccgtggttaatggtcgatgtcttt
ttaattggcgtattagtcagtctcataaaaatagcctcactagccgaggtagcgatgggt
tactccttctgggcattttgcttttttgccatgttggttgtgaaaaccgtttcgctagtc
gatcgctattggttgtggcaacactttattcccgcccaaactccccaaggagtcaacgct
gggcaaactcattgcacacacaactcggtcagttgccacacctgtcaacagattaacttg
ctcaggccagatcaaaaaaagcccacttgtttacgctgtggtagtcgtttacacgcttat
catccacagttgaatttgcagtgggcttgggcactgttactggctgccatcattttttac
attccagcgaatctttatccaatgatgtataccgtgagcctcggaaaatcagaaggctca
agcattatgcaaggggtgatccttctgtggcacctcggctcttatccggtggcgatggtg
attttcttagccagtatttttatccctatggccaaaatgtttgcactcggttggctctac
tggcaggccggaaaactcaatgtatttccagagcagcagaatctaaaacgtctcaaagtg
tatcgcgtaaccgaattcattggccgctggtcaatgattgatatcttcgtcgtggctatt
ttggtgtctttagtacagttgcataatctgatggcgatttatcccggcccggcagcgctc
tcttttgctgcagtagtattattgactatgctctcagccatggtttttgattcgcgaatc
ttgtggcatgagccgccagaatccccaccaacaaaaataaaatga

DBGET integrated database retrieval system