KEGG   Vibrio cholerae O1 MJ-1236: VCD_002644Help
Entry
VCD_002644        CDS       T00903                                 

Definition
(GenBank) leucyl/phenylalanyl-tRNA--protein transferase
  KO
K21420  leucyl-tRNA---protein transferase [EC:2.3.2.29]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VCD_002644
Enzymes [BR:vcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.29  aspartate/glutamate leucyltransferase
     VCD_002644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATE_C ATE_N PPO1_DWL
Motif
Other DBs
NCBI-ProteinID: ACQ60810
Position
1:complement(1793726..1794427)
Genome map
AA seq 233 aa AA seqDB search
MSSDIQQIRIGLTNNHPCSYLADRMERVAVAIDPQMQTPETYEVLMANGFRRSGDTIYKP
HCDHCQSCQALRIPAPDFVPSKSQKRLLKLLSQEFHWQLKPELDEDWYTLYARYIFARHR
HGSMYPPNKMEFAKFARAKWLNTQYLHLYQGEKLVAIAVTDLLPNSASAFYTFYDPDISI
SLGTLAVLCQLNYCQQTKKQWLYLGYQIDECPAMNYKVRFNPHQRLVNQRWRG
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagatattcagcaaattcgtattggcttaaccaataaccatccttgtagctac
ttagcggatcggatggagcgcgtcgccgtggcgattgatccgcagatgcaaacccccgaa
acctatgaagtgctgatggcaaatggttttcggcgcagcggcgataccatctacaaaccg
cattgtgatcattgccagtcttgccaagctctgcgaattcctgcgcccgattttgtgcca
agtaaaagccaaaaacgtttactcaagctgctcagccaagagtttcattggcagttgaaa
ccagaactggatgaagattggtacaccctttacgcgcgttatattttcgctcgtcatcgc
cacggctccatgtacccacccaataaaatggaatttgccaaatttgcccgtgcaaaatgg
cttaatacccaatatttacatctttatcagggcgaaaagttggtcgcgattgccgtcacc
gatttactcccaaacagtgcgagtgcgttttacaccttttatgacccagatatttcgatc
tctttaggcaccttagcggtactttgtcagctcaattactgccaacagaccaaaaagcag
tggctttatttgggatatcaaatcgatgaatgcccagctatgaactacaaagtccggttc
aatccacatcaaaggctagtaaatcaacgttggcgagggtag

DBGET integrated database retrieval system