KEGG   Vibrio cholerae O1 MJ-1236: VCD_002649Help
Entry
VCD_002649        CDS       T00903                                 

Definition
(GenBank) DNA topoisomerase I
  KO
K03168  DNA topoisomerase I [EC:5.99.1.2]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vcj03032]
    VCD_002649
   03400 DNA repair and recombination proteins [BR:vcj03400]
    VCD_002649
Enzymes [BR:vcj01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     VCD_002649
DNA replication proteins [BR:vcj03032]
 Prokaryotic Type
  DNA Topoisomerases
   VCD_002649
DNA repair and recombination proteins [BR:vcj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      VCD_002649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Topo_Zn_Ribbon Toprim zf-C4_Topoisom Toprim_4 Toprim_2
Motif
Other DBs
NCBI-ProteinID: ACQ60815
Position
1:1797385..1800015
Genome map
AA seq 876 aa AA seqDB search
MGKSLVIVESPAKAKTINKYLGKDFIVKSSVGHVRDLPTAGQTATPTGKAAAASTKKAST
TDKEQQKREKERAALIKKMGVDPYHGWQANYQILPGKEKVVAELQKLAKDADSVYLATDL
DREGEAIAWHLREIIGGDEKRYKRVVFNEITKNAIQQAFKQPGELNMDGVNAQQARRFMD
RVVGFMVSPLLWKKVARGLSAGRVQSVAVKLLVEREREIKAFVPEEFWDINADTLTADKQ
DFRLLVAQKDGLAFKPVNETEALAAVAALNKAQYEVCKREDKPTTSKPSAPFITSTLQQA
ASTRLGYGVKKTMMLAQRLYEAGYITYMRTDSTNLSAEAVENLRGYITKHYGEAYLPSQP
NVYGSKQNAQEAHEAIRPSDVTVTADDLEGMEADAHKLYALIWNQFVACQMTPAQYDSTT
VSVKAAEYTLKAKGRILKFDGWTRVQRPLGKNEDQILPPVKVGDSLKLVSLDPKQHFTKP
PARYTEAALVKELEKRGIGRPSTYASIISTIQDRGYVKVDQRRFFAEKMGEIVTDRLDEN
FDDLMNYDFTARMEEKLDQIAEGEVNWTAVLDEFFADFSRDLETAEQDESLGGMKPNHIV
MTNILCPTCSRPMGIRTASTGVFLGCSGYGLPPKERCKTTINLGDEEGVINVLEEDVETA
ALRAKKRCPICETAMDAYLIDDKRKLHVCGNNPNCEGFIVEEGEFKVKGYEGPTVECDKC
GSDMVLKNGRFGKYMGCTNDACKNTRKILKNGEVAPPKEEPVHFPELPCENSDAYFVLRD
GASGLFFAASNFPKSRETRAPLVEELKRFAERLPEKYQYLTSAPAHDPDGLPAVVRFSRK
EKEHYVRTETEGKPSGWMAVYQEGKWLVTDKRKNAK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatcactcgttatcgtcgagtcgccagccaaggctaaaaccatcaataagtac
cttggtaaagactttatcgtgaaatccagtgtgggacacgtgcgtgatctgcctacagca
gggcaaacggccacaccgaccggtaaagcggcggcagcatcgactaagaaagcatctact
actgataaagagcagcagaagcgtgaaaaagaacgcgcagcgctgatcaaaaagatgggt
gtcgatccgtatcacggctggcaagccaattaccaaattctgcccggtaaagagaaagtg
gtggctgagctgcaaaagctcgcgaaagacgctgacagcgtttatctcgcaaccgacttg
gaccgcgagggagaagccatcgcttggcaccttcgtgagatcatcggtggcgatgaaaag
cgatataaacgagtggtatttaacgaaatcaccaaaaacgccattcagcaggcttttaag
cagcctggtgaactgaatatggatggcgttaacgctcaacaagcacgtcgtttcatggac
cgcgtggtgggctttatggtctcgccactgctgtggaaaaaagtggcgcgaggcctttcc
gctggtcgtgtacagtctgtcgccgtgaaacttctggttgagcgtgaacgcgaaatcaaa
gcatttgttccggaagaattttgggacatcaatgccgataccttgaccgcagacaagcaa
gattttcgcctgttggtagcccaaaaagacggtttagctttcaagcccgtgaacgaaacg
gaagccttggcggcggttgctgcgctcaataaagcgcagtacgaagtgtgcaaacgcgaa
gacaaaccgaccaccagtaaaccgagtgcgcctttcattacgtcaaccctgcagcaagcc
gcgagtactcgccttggttatggggtgaaaaagaccatgatgctcgctcagcgtttgtat
gaagcgggttacatcacctatatgcgtaccgactcaaccaacttgagtgcggaagcggtc
gagaatctgcgtggttacatcaccaagcattacggtgaggcgtatttgccaagccagcca
aatgtgtatggcagcaagcaaaatgcccaagaggcgcacgaagcgattcgtccttcggat
gtgacggtcaccgccgacgatctggaaggaatggaagcggatgcacacaagctgtatgcc
ctgatttggaatcagtttgtggcttgtcaaatgacacctgcgcaatacgattccacgaca
gtcagtgtaaaagcggcagagtacaccctgaaagcgaaaggtcgtatcctcaagtttgat
ggttggactcgcgtacagcgcccgttgggtaaaaacgaagatcagatcctgcctccggtg
aaggtcggtgatagcctaaagctcgtcagcctagatccgaaacagcattttaccaaaccg
ccagcgcgttacacggaagcggcattggtgaaagagttagaaaagcgtggtattggtcgc
ccatcgacgtatgcatcgatcatttccaccattcaagaccgtggctatgtgaaagtcgat
cagcgccgtttcttcgcggaaaaaatgggtgaaattgtcaccgatcgtcttgatgagaat
tttgacgacttgatgaactacgactttaccgcgcgtatggaagagaaactcgaccaaatc
gccgaaggtgaagtgaactggaccgcagtactggatgagttctttgctgatttcagtcgc
gacctagaaacggcggagcaagatgaaagcttaggtggcatgaagcctaatcacatcgtg
atgaccaatattttgtgtccgacctgttcgcgtccgatggggatccgcacggcatcgaca
ggggtgtttttaggctgttctggctatggattaccgccgaaagagcgctgcaaaaccacc
atcaacttaggtgacgaagaaggggtgatcaacgttctcgaagaggatgtcgaaaccgca
gcactgcgtgctaagaagcgttgcccaatttgtgaaacggcgatggatgcgtatctgatt
gacgataagcgtaagctgcatgtttgtggtaacaatccgaactgtgaaggctttatcgtt
gaagaaggcgagttcaaagtcaaaggctatgaaggcccaaccgtcgagtgtgataaatgt
ggctcagacatggtgctgaaaaatggccgctttggtaagtacatgggttgtaccaacgat
gcttgtaaaaatacgcgtaagatcctgaaaaatggcgaagttgcgccaccgaaagaagag
ccagtgcatttccctgaactgccttgtgaaaattcggatgcgtattttgtgctgcgtgat
ggtgcatctggcttgttctttgcggcgagcaatttccctaaatcgcgtgaaacgcgcgcg
cctttggtggaagagttgaaacgttttgctgagcgtttgccagaaaaataccagtatctg
acttctgcacccgcacatgaccctgatggcttacctgctgtggtgcgcttctctcgtaaa
gagaaagagcattacgtgcggaccgagacagagggtaaaccttccggttggatggcggtt
taccaagagggtaaatggttggtcacggataaacgcaaaaacgcgaaataa

DBGET integrated database retrieval system