KEGG   Vibrio cholerae O1 MJ-1236: VCD_002651Help
Entry
VCD_002651        CDS       T00903                                 

Definition
(GenBank) glucose-1-phosphate adenylyltransferase
  KO
K00975  glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00500  Starch and sucrose metabolism
vcj00520  Amino sugar and nucleotide sugar metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
Module
vcj_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VCD_002651
   00520 Amino sugar and nucleotide sugar metabolism
    VCD_002651
Enzymes [BR:vcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     VCD_002651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Fucokinase Hexapep
Motif
Other DBs
NCBI-ProteinID: ACQ60817
Position
1:1800684..1801901
Genome map
AA seq 405 aa AA seqDB search
MAGVLGMILAGGEGSRLKPLTETRTKPAVPFGGSYRLIDFALNNFVNADLMRIYVLTQFK
SQSLYIHMKKGWNLSGITDRFIDIIPAQMRDGKRWYEGTADAIYQNLRFVEIVAPDQVCI
FGSDHIYKMDIRQMLDFHRRMEAELTVSALRMPISQASQFGVIEVDENGKMVGFEEKPSN
PKSIPGEPEWALVSMGNYIFEAETLSKELREDAENNQSSHDFGKDIIPKMFPRGKVYVYD
FTTNKIKGEKESTYWRDVGTIESYWSAHMDLLDKDPEFSLYNRSWPLHTYYPPLPPATFV
DVKDKKVKITDSLISGGSYIQGSTIYKSVLGFRSNIAAGSFISESVILGDVKIGAGCTIK
RAIIDKDVEIAAGTIIGEDLEMDRKRFHVSDEGIVVIAKGSKVGF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctggagtattaggcatgattttggcgggaggagaagggtcacgtttgaagccgttg
actgaaacccgtaccaagccggcagttccttttggtggaagctaccgtttaatcgacttt
gcactcaataatttcgtgaatgccgatttaatgcggatttatgttctgacgcagttcaaa
tcgcaatcgctatacattcatatgaaaaagggctggaatctttccgggatcaccgaccgt
tttatcgacattattccagcacagatgcgtgatggaaaacgttggtatgaaggcactgcc
gatgcgatttatcaaaacctccgttttgttgagatcgtcgcgccggatcaagtctgtatt
tttggttcagaccatatctacaagatggatattcgccaaatgctcgattttcatcgccgt
atggaagcggagttgaccgtttctgcactgcgtatgccgatcagccaagcctctcagttc
ggggtgattgaagtggatgaaaacggcaaaatggtcggttttgaagagaaaccgagcaat
cccaaatcgatccccggtgagcctgagtgggcactggtctcgatgggtaactacatcttc
gaagcggaaacgctcagcaaagaactgcgtgaagatgctgaaaataaccagtccagccat
gactttggcaaagacattattccgaaaatgttcccgcgcggtaaagtctatgtgtatgac
ttcacgaccaacaaaattaagggagagaaggaatcgacctactggcgtgatgtcggaacc
atcgaatcgtattggtcggcacatatggacttgctcgacaaagatccagaattttcgcta
tacaaccgtagttggccgctgcacacctactatcctcctttgccacctgcgacgtttgtg
gatgtcaaagacaagaaagtcaaaatcacagatagcttgatctctgggggaagttatatc
caaggatcaaccatttataaatcagttctgggtttccgtagcaacattgctgctggctct
tttatcagtgaatctgttatcttgggcgacgtgaaaattggagctggctgcacgattaag
cgcgccattatcgataaagatgtcgagatcgccgccggtaccatcattggtgaagatttg
gaaatggacagaaagcgtttccacgtttccgatgaagggattgtggtgattgcgaaaggt
agtaaggtaggattctag

DBGET integrated database retrieval system