KEGG   Vibrio cholerae O1 MJ-1236: VCD_002657Help
Entry
VCD_002657        CDS       T00903                                 

Definition
(GenBank) DNA transformation protein TfoX
  KO
K07343  DNA transformation protein and related proteins
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    VCD_002657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TfoX_C TfoX_N
Motif
Other DBs
NCBI-ProteinID: ACQ60821
Position
1:complement(1805758..1806345)
Genome map
AA seq 195 aa AA seqDB search
MDKPVLKDSMRLFEQLGRVKSRSMFGGFGIFVDETMFALVVNDTLHIRADDATIEKYKQQ
GYEPYVYKKRGFPVVTKYYALPEDCWSHPDSILNEVRAALEVAKAERETQAQAKPDRLKD
LPNLRLATERMLKKAGIDTVESLQTLGSVEAYKAVQRTHTAEVSLELLWALEGAIEGKHW
SVIPQNRRDELLRHL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccagtattaaaagattcaatgcggctctttgagcagctaggacgtgttaaa
tctcgttcaatgtttggtggctttggtattttcgtcgacgaaactatgtttgcgcttgtg
gttaacgatacgctgcacatccgtgcagatgacgccacaatcgaaaagtataaacagcaa
ggttatgaaccttatgtttacaaaaaacgtggcttccccgttgtaactaagtactacgct
ctacctgaagattgttggagtcatccagactctatcctcaatgaagtgcgtgcagcactg
gaggtcgctaaggccgaacgtgaaactcaagcacaagcgaaacctgatcgtttgaaagat
cttcctaacttgcgtttagcaacagaaagaatgctcaaaaaagcaggtatcgacaccgtc
gagtctcttcagactcttggttctgtcgaagcttataaagcggttcaacgaacccacacg
gcagaggtgagtttagagttgctatgggctctagaaggcgcaatcgaaggtaaacattgg
tcggtgatcccacaaaatcgtcgtgatgagctattaaggcatctctga

DBGET integrated database retrieval system