KEGG   Vibrio cholerae O1 MJ-1236: VCD_002660Help
Entry
VCD_002660        CDS       T00903                                 

Definition
(GenBank) TorCAD operon transcriptional regulatory protein TorR
  KO
K07772  two-component system, OmpR family, torCAD operon response regulator TorR
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj02020  Two-component system
Module
vcj_M00455  TorS-TorR (TMAO respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCD_002660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcj02022]
    VCD_002660
Two-component system [BR:vcj02022]
 OmpR family
  TorS-TorR [MD:M00455]
   VCD_002660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACQ60824
Position
1:1809008..1809712
Genome map
AA seq 234 aa AA seqDB search
MSYHVLVVEDDLVTRSKLSGYFQNEGYQVTEAESGAQMREALELNDIDLVLLDINLPGED
GLLLTRELRSQSEIGIILVTGRTDSIDKIVGLEMGADDYVTKPVDLRELQVRVKNLLWRI
SLAQRERITDKHDDKLVHFGEWTFDVQRRALSRNGEPVKLTKAEYELLVALSSYPNQVLS
RERILNMISHRVDAPNDRTIDVLIRRMRAKMEMDPKNPQIFVTVHGEGYMFAGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcacgtacttgtggttgaagatgacctcgtcacgcgaagtaagttaagtggt
tactttcaaaatgaaggttaccaagtgacggaagcagaaagtggcgcacagatgagagaa
gcgttagagctcaatgacatcgatctggttttgctggacattaatttgcccggtgaagac
ggtctgttattgacgcgagaattacgcagccagtcggagattggcattattttagtgaca
ggacgcaccgacagtatcgacaaaatcgttggcctcgaaatgggcgcggacgattatgtc
acaaaacctgttgacctacgcgagcttcaggttcgtgtaaaaaacttattatggcgaatt
tccctcgcacagcgagagagaattaccgacaaacacgatgacaaactggtgcattttggt
gagtggacgttcgatgttcagcgccgtgcattaagccgtaatggtgagccagtcaagctc
actaaagcggaatacgagttgttggttgcgctttcttcttatcctaatcaagtgctgagc
cgtgagcggattttgaacatgatcagtcaccgtgtggatgcgccaaacgaccgtacgatt
gacgtattgatccgccgtatgcgcgccaaaatggaaatggatccgaaaaacccgcaaatc
tttgtgacggttcacggcgaagggtacatgttcgctggggattaa

DBGET integrated database retrieval system