KEGG   Vibrio cholerae O1 MJ-1236: VCD_002662Help
Entry
VCD_002662        CDS       T00903                                 

Definition
(GenBank) S-adenosylmethionine-dependent methyltransferase functionally coupled to the MukBEF chromosome partitioning mechanism
  KO
K06219  S-adenosylmethionine-dependent methyltransferase
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    VCD_002662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_23 Ubie_methyltran MTS rRNA_methylase Methyltransf_24 Desulfoferrod_N
Motif
Other DBs
NCBI-ProteinID: ACQ60826
Position
1:1810750..1811532
Genome map
AA seq 260 aa AA seqDB search
MTEDRNFDDIAHKFAKNIYGSDKGEIRQVIVWEDLEQLLSQLDTQKVPLHVLDAGGGLAQ
VSQKIARLGHRVTLCDLSSEMLQLAEQDIANNGLLEQYRFVHSPVQTIQAHLDAPVDLVL
FHAVMEWLAEPKPALQNLLAQVRPGGMVSVMFYNYHGLVYKNAVCGNIPHVLEDMPHRKR
FKLQPQKGLLPEEVYQWIEESSFEICGKSGIRCFSDYIGNMKNMGEYQYEDLVALERKFC
RQEPYLSLGRYIHVWAKKKQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgacagaagatcgcaatttcgacgatattgcccacaaatttgcaaaaaatatatacggt
tctgacaaaggtgagatccgccaagtcattgtttgggaagatttggagcagcttctcagt
caactggacacgcaaaaagttcccttgcacgtgctcgatgcgggtggcggcttggcgcaa
gtatcgcaaaaaatcgctcgccttgggcatcgagtgacactctgtgatctttcttcggaa
atgttgcaattggccgaacaggatattgcaaacaatggcctgcttgagcagtatcgcttc
gtccattcaccagtgcagacgattcaagcacaccttgatgcgcccgtggatttggtgctg
tttcatgcggtgatggaatggttagcggagcccaaaccggcgttgcaaaatttgttggcg
caagttagaccgggcggcatggtgtcggtgatgttttacaactatcacggtttggtttac
aaaaacgccgtgtgtggcaacattccgcacgtgctagaggatatgccgcaccgcaaacgg
tttaaattacaaccgcagaaaggcttgctccccgaagaggtctaccaatggatcgaagaa
tcgagttttgagatctgcgggaaatccggtattcgttgtttcagtgattacatcggaaac
atgaaaaacatgggcgaataccagtatgaggatttggtggcactggagcgcaaattctgc
cgtcaggagccttacctctcattaggccgatacatccacgtatgggctaagaaaaaacaa
taa

DBGET integrated database retrieval system