KEGG   Vibrio cholerae O1 MJ-1236: VCD_002663Help
Entry
VCD_002663        CDS       T00903                                 

Definition
(GenBank) chromosome partition protein MukF
  KO
K03633  chromosome partition protein MukF
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vcj03036]
    VCD_002663
Chromosome and associated proteins [BR:vcj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   MukBEF complex
    VCD_002663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MukF_M MukF_C KicB BTG COG2
Motif
Other DBs
NCBI-ProteinID: ACQ60827
Position
1:1811544..1812881
Genome map
AA seq 445 aa AA seqDB search
MSEFTQDTVQKPIDELVTWVKQYDFSLNLPTERLAFLLAIAVLSNERFDEELGEGELHDA
FAIVTRLFAESGEASAFRANNAINDLVKQRLLSRFTSEMTEGASIYRLTPLAIGITDYYV
RHREFSKLKLSIQLSMVADEMAKAVESAQQGGSVAHWRKNVFGVLKYSVSEIFDRIDLNQ
RVMDEQQQSVKEQIADLLNKDWRDAINNCEALLSETSATLRELQDTLQAAGDELQTQILD
IQECVYGDLELDFIEETLSALQMKLDRITSWGQQSIDLWIGYDRHVHKFIRTAIDMDQNR
AFSQRLRQSMNDYFEQPWYLTYADAERLSDLRDETLTLRDEEVTGHVPTEVEYEELQQVN
DELAQRIGDMLKVHKEQGAAIDLALVLRDYLASHPRTHHFDLARMVVDQAVRLGYSESDY
RAIQPDWTAINDFGAKVQANVIDRY
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtttactcaggatactgtgcaaaagcccatcgacgaactcgtcacttgggta
aaacagtatgacttctcattgaatctgcctactgagcggctggcatttttgctcgcgatt
gctgtgctcagtaatgaaagatttgatgaagagctcggagaaggggaacttcacgatgca
ttcgcgatagtcacgcgcttgtttgcagaatcgggagaagcctcagcctttcgggctaac
aatgcgattaatgatctggtcaaacagcgcttactaagccgctttaccagcgaaatgacg
gaaggtgccagcatctaccgtttgacccctttagcgatcggcattaccgattactatgtt
cgtcatcgcgaattttccaaactgaaactatccatccaactctctatggtcgcggatgag
atggcgaaagccgtggaatcggcgcagcagggtggcagtgtcgcccattggcgcaaaaac
gtgtttggcgtgctcaaatattcggtgagtgaaatcttcgatcgcatcgaccttaaccag
cgtgtgatggatgagcagcagcaatcggtcaaagagcagattgcggatctgctgaataaa
gattggcgcgatgcgatcaacaactgtgaagccttgctgtctgagacttccgccacactg
cgtgagctgcaagataccttgcaagcggcaggcgatgagttgcaaacgcaaatcctcgat
attcaggagtgcgtgtatggcgatctggaattggatttcatcgaagagacgctgtctgcg
ctgcaaatgaagctcgaccgcattacgagctggggtcagcagtcgattgatctttggatt
ggttacgatcgccacgtccacaagtttattcgtaccgcgattgatatggaccagaaccgc
gcgttcagccaacgtctgcgtcagtcaatgaacgactattttgaacaaccttggtatctc
acttacgccgatgcagaacgtctatccgatctgcgtgatgaaaccttgaccctgcgtgac
gaagaagttaccggtcatgtgccgacagaagtggaatacgaagagctgcaacaagtgaac
gatgaacttgcgcagcggattggcgacatgctgaaagtgcataaagagcagggcgcagca
attgatttagcacttgtgctgcgtgattacctagctagccatccacgaacccatcatttc
gatttagcccgaatggttgtcgaccaagcggtaagactgggttactccgagtccgactac
cgcgctatccagcctgactggacggcgatcaacgattttggcgcaaaggtacaagcgaat
gtcatcgaccgatattaa

DBGET integrated database retrieval system