KEGG   Vibrio cholerae O1 MJ-1236: VCD_002665Help
Entry
VCD_002665        CDS       T00903                                 

Definition
(GenBank) chromosome partition protein MukB
  KO
K03632  chromosome partition protein MukB
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vcj03036]
    VCD_002665
Chromosome and associated proteins [BR:vcj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   MukBEF complex
    VCD_002665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MukB MukB_hinge SbcCD_C AAA_29 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACQ60829
Position
1:1813581..1818056
Genome map
AA seq 1491 aa AA seqDB search
MIERGKYQSLTMINWNGFFARTFDIDNLVTTLSGGNGAGKSTTMAAFITALIPDQSLLHF
RNTTEAGSSQASRDKGLYGKLQAGACYAALDVVNSRNQRLLFAVKLQQVAGRDKKVDIKP
FLIQGLPSHVKPTDVLVETVSDKHARVRQINEVKDAVGQIEGAHFKSFPSIVDYHAQMFE
FGVIPKKLRNSSDRSKFYRLIEASLYGGISSAITRSLRDYLLPQNGGVKKAFQDMESALR
ENRMTLEAIKTTQADRDLFKHLITESTNYVAADYMRHANDRRNKVGQTLVLRGELFSSRE
TLIEQNSLLNRVHEELELLVEQESALEQDYQGASDHLQLVQNALRQQEKIERYQEDLEEL
NFRLEEQMMVVEEANERVMQAEERAIISEEEVDSLKSQLADYQQALDVQQTRALQYQQAV
QALDKARRLLDKSELTAESAQALATQLKAEQETRTSELLALKHKLDMSSAAAQQFNHAFE
LVKRVLGEVARSEAAKQAQQVIRQAREAQNVVQNEAQWQAQQRDLERQLEQQRSVRELAT
QYHKQHRVVLDDAATVELERERHSALLEELETEQENCREQRGQLRHQEQELQTQIARFES
IAPAWIKANDALETLREQSGAELADSQSVMAHMQQVLELEKAQSMAKDKLAERRTKLDSE
IERLASPGGSNDPRLKGLADTLGGVLLSEIYDDITIDDAPYFSAMYGPARHAIVVSDLSG
IKEKLVELDDCPEDLYLIEGDVDAFDDSSFNAEELEGAVCVQLNQRQMRYSRFPAIPLFG
RAAREQRLELLREERDDVVEQHAKASFDSQKLQRLYASFNQFVAMHLQVAFDADPEQALA
TARDKRNQLLRSISEFEAQEQQLRSQLQASKQALAALDKLAPQMGLLDEETLEARYHELE
EKLQQLSEAKAFIAAHGRTISELEKVAAVLDADPEQFDALEQQYQQADQALQQLKAQIFA
LSDLLERRHHFAYSDSVDLLNQSSELSEQLKAKLVQAESERTRSREELKQAQAQLSQYNQ
LLASLKSSHQAKLETVQEFKQELQEFGVHADEGAIERAQRRRDELQERLHTSRSRKSEYE
RTITSTELEMKALVKRMKKVEKDYQDLRTFVVNAKAGWCSVLRLARQNDVERRLHKRELA
YLSADELRSMSDKSLGALRLAVANNEDLRDALRQSEDNSRPERKVLFYIAVYQHLRERIR
QDIIRTDDPVEAIEEMEVELARLTEELTQREQRLAISSDSVASIIRKTIQREQNRIRMLN
QGLSNISFGQVNGVRLNVKVRESHEILLAGLSEQQAQHKDLFESARYTFSEAMAKLFQRV
NPHIDMGQRSPQVLGEELLDYRNYLELSVEVNRGSDGWLQAESGALSTGEAIGTGQSILL
MVVQSWEEESRRLRSKDIVPCRLLFLDEAARLDAKSIATLFELCERLDMQLLIAAPENIS
PEKGTTYKLVRKVFKDHEHVHVVGLRGFAQTEKPKTAEQKFAEELAGELTE
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacgaggtaaatatcaatcgctaaccatgatcaactggaacggcttctttgcg
cgtacctttgacattgataatttagtgaccactttatccggtggtaacggtgccggtaag
tctaccaccatggcagcgtttatcaccgctttgatcccagaccaaagcctgctccatttt
cgtaacaccaccgaagcgggaagctcgcaagcgtctcgcgataaaggtttgtacggtaag
ttgcaagcgggggcgtgttacgccgcgttagatgtggtgaactcacgtaaccaacgttta
ctgtttgcggtgaagctgcaacaagtggcggggcgtgataagaaagtggatatcaaacct
ttcttgatccaaggtttgccaagtcatgttaaaccgaccgatgtgttggtcgaaaccgtg
tccgacaaacacgcgcgtgttcgccaaatcaatgaagtgaaagatgccgtgggtcaaatt
gaaggcgcgcatttcaaatctttcccgtcgattgtcgactaccacgcgcagatgtttgaa
tttggcgtgatcccgaaaaaactgcgtaacagttcagaccgttcaaaattctaccgtttg
attgaggcttcgctttacggcggcatttccagtgcaatcacccgctcactgcgtgattat
ctgctgccacaaaatggcggcgtgaagaaagcgttccaagatatggaatccgcgctgcgt
gaaaaccgcatgacgctggaggcgatcaagaccacgcaagcggatcgcgatctgttcaaa
cacctgatcaccgaatcgaccaattatgtggctgcggactacatgcgccatgccaatgat
cgccgtaacaaagtgggacaaactttggttctgcgcggtgagctgttctcttctcgtgaa
accctgattgaacaaaacagcttgctgaaccgtgttcatgaagagttagaactgctggtt
gagcaagagtcggcgctggagcaagattaccaaggcgcgtctgaccacctgcaattggtg
caaaatgcgctgcgtcagcaggaaaaaattgaacgctatcaagaagatctcgaagagctg
aatttccgcctcgaagagcagatgatggtggtcgaagaagccaatgaacgagtgatgcag
gctgaagagcgtgcgatcattagcgaagaggaagtcgatagcctcaaatcgcaattggcc
gattatcagcaagcccttgatgtgcagcagacccgtgctctgcaataccaacaagcggtg
caagcgctcgataaagcgcgtcgcttgctggataagtcagaactcactgcggaaagtgcg
caagcgttagcaactcaactgaaagcggagcaggaaacgcgcaccagtgaattgttggca
ctcaaacacaagctggatatgtcttcggccgcggcgcagcagttcaaccatgcgtttgaa
ttggtgaaacgcgtgttgggtgaggtcgcgcgcagtgaagctgcgaagcaagcgcagcaa
gtgatccgtcaagcgcgtgaagctcagaatgtggtgcaaaatgaagcgcagtggcaagca
caacaacgtgatcttgagcgccaacttgagcagcaacgcagcgtgcgtgagctggcaacc
caataccacaagcaacatagggtggtcttggatgatgccgcgaccgtcgagttagagcgt
gagcgccactctgcactgctagaagagctggaaaccgagcaggaaaactgccgcgaacag
cgtggtcagctgcgccatcaagagcaagaactgcaaacgcaaatcgcccgttttgagtca
attgcgccagcatggatcaaagctaacgatgcgttagaaacgctacgcgagcaaagtggt
gccgaactggcggatagtcagtctgtcatggcgcacatgcagcaagtgttggagctggaa
aaagcccaatccatggcgaaagataaactcgccgagcgtcgcacgaaactcgatagcgaa
attgagcgtttagcgtctccgggtggctctaacgatccgcgtctgaaaggtctggcggat
acgctcggcggtgtgctgctgtctgaaatctatgacgacatcaccattgatgatgcgccg
tatttcagtgcgatgtacggtcctgcgcgtcacgcgattgtggtgtcggatctctctggc
attaaagaaaaactggttgaactggatgactgtccggaagatctctacctcatcgaaggc
gatgtggatgcgtttgatgacagctcattcaatgctgaagagctggaaggcgcggtgtgc
gttcagcttaaccagcgtcaaatgcgctactcgcgctttccagccattccactgtttggc
cgtgcggcgcgtgagcagcgtttagagctgctacgtgaagagcgtgatgacgtggttgag
caacacgccaaagcttcgttcgattcgcaaaagctgcaacgtctgtacgccagcttcaac
cagtttgtggcgatgcatttgcaagtggcgtttgatgctgaccctgaacaagccttggcg
actgcgcgcgataagcgtaatcaactgctgcgctccatcagcgaatttgaagcgcaagag
cagcaactgcgtagccagttgcaagcgagcaagcaagcgctagctgcgctagacaaactc
gcgccgcaaatgggtctacttgacgaagagacgctcgaagctcgttatcacgagcttgaa
gagaaactgcaacagctgagtgaggccaaagcctttatcgctgcccatggccgcaccatc
agcgagctggaaaaagtggcggcggtactcgatgccgacccagagcagtttgatgcactg
gagcagcaataccagcaagcggaccaagcactgcagcaactcaaagcgcaaatttttgca
ctgtcggatctgcttgaacgtcgtcatcactttgcttattccgactcggtggatctgctt
aaccaaagcagtgagctgagtgaacagctcaaagcaaaattggtgcaggcggaaagtgaa
cgtacccgcagtcgtgaagagctgaaacaggcgcaagctcagctcagccaatacaatcag
ctgttggcgtcactgaaaagttcgcaccaagctaagctagaaacggtgcaagagttcaaa
caagagctgcaagagtttggtgtgcatgctgacgaaggtgcgattgagcgtgctcagcgt
cgccgcgatgagctgcaagagcgtctgcacacttcacgcagccgtaagagtgaatacgaa
cgcaccatcacatctactgagctggaaatgaaagcgctggtcaagcgcatgaagaaagtc
gagaaagattatcaagacctgcgcactttcgtggtgaacgcgaaagcgggttggtgctca
gtcttgcgtcttgcgcgccaaaatgatgttgaacgtcgtctgcacaagcgtgagctggct
tacctgtcggctgatgaactgcgttcaatgtcggataaatccttgggcgcgctacgtctc
gcggtcgctaacaatgaagatctgcgtgatgcactgcgtcagtcggaagataactcacgc
cctgagcgtaaagtgctgttctacattgccgtgtatcagcatctgcgtgagcgcattcgt
caagacatcattcgcactgacgatccggtcgaagcgattgaagagatggaagtggaactg
gctcgtttgaccgaagagttgactcagcgtgaacagcgtttggcgatcagttcggattcg
gtagccagcatcatccgcaaaaccattcagcgtgagcaaaaccgaattcgcatgctcaac
caaggactgtcgaatatctcctttggtcaggtgaatggcgtgcgtctgaatgtgaaagtg
cgtgagagccatgaaatccttttagcaggattgtctgagcagcaagcgcaacacaaagat
ctgtttgaaagtgcgcgttacaccttctcagaagcgatggcgaagctgttccaacgtgtg
aacccacacatcgacatgggtcaacgttcaccgcaagtgctgggtgaagagctgctggat
taccgtaactacctagagctgagtgtggaagtcaaccgtggttcggatggttggctgcaa
gcggaatcgggcgcattgtcgactggtgaagcgatcggtaccggtcagtcaatcctgctg
atggtggtgcagagctgggaagaagagtcgcgtcgtctgcgcagtaaagatattgtgccg
tgtcgcctgttgttcctcgatgaagccgcgcgtctggatgctaaatccatcgccaccttg
tttgagctgtgtgagcgtctggatatgcagttactgattgcagcgccagagaacatcagc
ccagagaagggcaccacttacaaactggtacgtaaagtgtttaaagatcacgaacacgta
catgtggtagggttacgcggctttgcgcaaaccgaaaagccaaaaaccgctgagcagaag
ttcgccgaagaacttgcaggtgagttgacggaatag

DBGET integrated database retrieval system