KEGG   Vibrio cholerae O1 MJ-1236: VCD_002672Help
Entry
VCD_002672        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4250 DUF5333 KLRAQ
Motif
Other DBs
NCBI-ProteinID: ACQ60836
Position
1:1828352..1828555
Genome map
AA seq 67 aa AA seqDB search
MMDLSNVRNFDSVILLGIVNEKLRLECDSLDELISTYEMDIEHLVGKLDVLGYQYDPLTN
QFKAYAR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatctgagcaacgtacgaaacttcgatagcgtgatcttgctgggcatcgtcaat
gaaaaactgcgtttggaatgtgacagcctggatgagttgatcagcacttatgaaatggat
attgagcatctggtcggtaagttagacgtactgggttatcaatacgatcctcttaccaac
cagttcaaagcttatgctcggtag

DBGET integrated database retrieval system