KEGG   Vibrio cholerae O1 MJ-1236: VCD_002675Help
Entry
VCD_002675        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSS_2 ATP13
Motif
Other DBs
NCBI-ProteinID: ACQ60839
Structure
PDB: 

Position
1:complement(1832435..1832893)
Genome map
AA seq 152 aa AA seqDB search
MSRRVFMPTSLLNLSKKYSDMKKIVLSSVIASTLLLVGCSSGSAEKQRNLELLAGNRASL
LSTELPLEFGPLNILRATAKGSTVELMMVYNTDANNAKPTEQVLQSAVSSFCANKDIRSN
LDVGISYRIQMRNTRGQLMADQLVTKESCKQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcgggtgtttatgccaacgtcattgttaaacctttcaaaaaagtattctgat
atgaaaaaaatcgtcctgagcagcgttatcgcctcgactctccttctcgtcggttgcagc
tctggctcagcagaaaaacagcgtaaccttgagctattggcgggtaaccgcgccagctta
ctctcgaccgagttaccattggagtttggcccactgaatattctccgtgctaccgccaaa
ggcagtactgttgagctaatgatggtgtacaacacggatgccaataacgccaaaccgacc
gagcaagtactgcaaagcgcggtcagcagcttctgtgctaacaaagacatccgttcgaat
ctggatgttgggatcagctaccgcatccaaatgcgcaacacgcgtggtcaattaatggcc
gatcagttggtcacgaaagagagctgcaagcaaggttaa

DBGET integrated database retrieval system