KEGG   Vibrio cholerae O1 MJ-1236: VCD_002676Help
Entry
VCD_002676        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
  KO
K09780  uncharacterized protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VCD_002676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YCII DUF1330
Motif
Other DBs
NCBI-ProteinID: ACQ60840
Position
1:complement(1832835..1833131)
Genome map
AA seq 98 aa AA seqDB search
MWYVIFAQDVENSLEKRLSVRPKHLERLQQLQDEGRLLTAGPMPAIDSENPGQAGFTGST
VIAEFASLVEAQAWADADPYVAAGVYANVIVKPFKKVF
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatgtgatttttgcgcaggatgtcgagaactcattagaaaaacgtctgagcgtg
cgcccaaaacatctggagcgtttacaacaactgcaagatgaaggccgtctgctcactgca
ggccccatgccagccatcgattccgaaaatccgggacaggcaggctttactggctcaacc
gtgatcgcggagttcgcctccttagttgaagcacaagcttgggcggatgccgatccttat
gtcgcggcgggtgtttatgccaacgtcattgttaaacctttcaaaaaagtattctga

DBGET integrated database retrieval system